KEGG   Thauera humireducens: AC731_010055Help
Entry
AC731_010055      CDS       T04211                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
thu  Thauera humireducens
Pathway
thu00630  Glyoxylate and dicarboxylate metabolism
thu01100  Metabolic pathways
thu01120  Microbial metabolism in diverse environments
thu01200  Carbon metabolism
Module
thu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
thu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:thu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AC731_010055
Enzymes [BR:thu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AC731_010055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AMO37266
UniProt: A0A127K5M8
LinkDB All DBs
Position
2128200..2128625
Genome map
AA seq 141 aa AA seqDB search
MRITQGCFSFLPDLTDTQIAAQINYCLDQNWAVALEFTDDPHPRNTYWNMWGLPMFDLRD
PAGVMGELKACREANPETYIRINAFDSTKGWETVRMSFIVQRPTAEPGFRLVRQETRGRN
LRYTMESYAVGRNPEGARYAP
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcacccaaggctgcttttccttcctgcccgacctcaccgacacccagatcgcc
gcgcagatcaactattgcctggaccagaactgggccgtcgccctcgaattcaccgacgac
ccccacccgcgcaacacctactggaacatgtggggcctgccgatgttcgacctgcgcgac
ccggccggcgtcatgggcgagctcaaggcctgccgcgaggccaaccccgagacctacatc
cgcatcaacgccttcgactccaccaagggctgggagacggtgcgcatgtccttcatcgtc
cagcgccccaccgccgagcccggcttccgcctcgtccgccaggaaacccgcggccgcaac
ctgcgctacacgatggagagctacgccgtcggtcgcaacccggaaggcgcgcgctatgcg
ccctga

DBGET integrated database retrieval system