KEGG   Thauera humireducens: AC731_012265Help
Entry
AC731_012265      CDS       T04211                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
thu  Thauera humireducens
Brite
KEGG Orthology (KO) [BR:thu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AC731_012265
Enzymes [BR:thu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AC731_012265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored FAD_binding_3 AlaDh_PNT_C K_oxygenase NAD_binding_8 NAD_binding_7 Thi4 FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AMO37649
UniProt: A0A127K6T9
LinkDB All DBs
Position
complement(2618567..2620132)
Genome map
AA seq 521 aa AA seqDB search
MLDANIKTQLKAYLERVTQPIEIVASLDDGPKSQEMRELLRDVAEQSALITLTESGNDAR
KPSFSVGPKGGEGRVRFAGLPMGHEFTSLILALLQSAGYPPKVEADVIEQIKSLEGEFNF
ETYISLSCHNCPDVVQALNLMAILNPNIRHTMIDGALFQKEVEERQIMAVPTVYLNGQEF
GQGRMELGEILAKVDTGAAARDARKLSDKAAFDVLVVGGGPAGAAAAIYAARKGIRTGIV
AERFGGQVMDTMAIENFISVKYTEGPKLVASLEEHVKEYEVDVMNLQRVAKVVPGSEDGT
TLAEVQLENGATLKSRTVIVATGARWREMNVPGEKEFRGKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVAHVTLLEFADELRADAVLQKKLYSLPNVTVIKSAQTTEVTGT
DKVNGLVYKDRKTDETHRIELEGIFVQIGLLPNTDFLKGSLELSRFGEIIVDAKGQTSVP
GVFAAGDCTTVPYKQIIIAMGEGAKASLSAFDHLIRTSTPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgccaatatcaagactcaactgaaagcctacctggagcgggtgacgcagccg
atcgagatcgtggcgtcgctggacgacggtcccaagtcgcaggaaatgcgcgaactgctg
cgcgatgtcgccgagcagtccgcactgatcaccctgaccgagagcggcaacgatgcgcgc
aagccgtccttctcggtcggccccaagggcggtgagggccgcgtgcgctttgccggcctg
ccgatgggccacgaattcacctcgctgatcctcgccctgctgcagtcggccggctacccg
ccgaaggtcgaggccgacgtgatcgagcagatcaagagcctcgaaggcgagttcaacttc
gagacctacatctcgctgtcctgccacaactgcccggacgtggtgcaggcgctgaacctg
atggcgatcctcaaccccaacatccgccacaccatgatcgatggcgcgctgttccagaag
gaagtggaagagcgccagatcatggcggtgccgacggtgtacctgaacggccaggagttc
ggccagggccgcatggagctgggcgagattctcgccaaggtcgataccggcgccgcggcg
cgcgatgccaggaagctgtcggacaaggctgccttcgacgtgctcgtcgtcggcggcgga
ccggccggcgcggccgcggcaatctacgccgcgcgcaagggcatccgcaccggcatcgtt
gccgagcgcttcggtggccaggtcatggacacgatggcgatcgagaacttcatctcggtg
aagtacaccgaaggtccgaagctggtggccagcctggaggagcacgtcaaggaatatgaa
gtcgacgtgatgaacctgcagcgcgtcgccaaggtcgtgccgggcagcgaggacggcacc
acgctggctgaagtccagctcgagaatggcgccacgctgaaatcgcgcaccgtcatcgtc
gccaccggcgcgcgctggcgcgagatgaacgtgccgggcgagaaggagttccgcggcaag
ggcgtggcctactgcccgcactgcgacggtccgctgttcaagggcaagcgcgtagcggtg
atcggcggcggcaattccggcgtcgaggcggcgatcgacctcgccggtgtggtggcccat
gtcaccctgctcgagttcgccgatgagctgcgtgcggacgccgtgctgcagaagaagctc
tacagcctgcccaacgtcaccgtcatcaagagcgcgcagaccacggaagtcaccggcacc
gacaaggtcaatggcctggtgtacaaggaccgcaagaccgatgagacgcaccgcatcgag
ctggaagggatcttcgtgcagatcggtctgctgccgaacaccgatttcctgaagggttcg
ctcgaactgagccgcttcggcgagatcatcgtcgacgccaagggccagacttcggtgccg
ggcgtgttcgccgccggcgactgcaccacggtgccgtacaagcagatcatcatcgcgatg
ggcgagggggccaaggcctcgctgtcggccttcgaccacctgatccgcaccagcacgccg
gcctga

DBGET integrated database retrieval system