KEGG   Thauera humireducens: AC731_013905Help
Entry
AC731_013905      CDS       T04211                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
thu  Thauera humireducens
Pathway
thu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:thu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AC731_013905
Enzymes [BR:thu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AC731_013905
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AC731_013905
    1.1.1.-  
     AC731_013905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AMO37928
UniProt: A0A127K7I4
LinkDB All DBs
Position
2957744..2958811
Genome map
AA seq 355 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPVVAPGTVGIEVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVDDIEVGQHVVVEPYIVADDVPTGPGQNYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISRNIPLDQAALIEPLSVGHHAWSRSGAKAGDVALVG
GAGPIGLLLSAILKAKGLTVIITELSAKRKEKARESGVADHILDPSEVDVVAETMKLTGD
KGVDVSFECTSVNKVLDALVAATKPTGVVVIVSIWSHPATINVHSVVMKELDVRGTIAYC
NDHRETIKLVEQGKIDLEPFITQRIQLDDLVSQGFDTLIHNNESAVKIIVQPRLK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttttacgaccgcggcgacatccgcatcgaagacatccccgaaccc
gtcgtggcgccgggcaccgtcggcatcgaagtggcctggtgcggcatctgcggcaccgac
ctgcacgagttcatggaagggccgatcttcattccgccctgcggccatccgcacccgatt
tccggggaatccgctcccgtcaccatgggccacgagttttccggcgtggtgtatgcggtc
ggcgaaggcgtggacgacatcgaagtcggccagcatgtggtggtcgaaccctacatcgtg
gccgacgacgtgcccacgggaccgggccagaattaccacttgtcgaagaacatgaacttc
atcggcctgggcggccgcggcggcggcctgtccgaaaagatcgccgtcaagcgccgctgg
gtgcacccgatctccaggaacatcccgctggaccaggccgccctgatcgaacccttgtcg
gtgggccaccacgcctggagccgcagcggcgccaaggccggcgatgtggccctggtcggc
ggcgccggcccgatcggcctgctgctgtcggcgatcctgaaagccaagggcctgaccgtc
atcatcaccgagctgagcgccaagcgtaaggaaaaggcccgcgaatccggcgtcgccgat
cacatcctggacccgtccgaagtggatgtggtggcggaaacgatgaagctcaccggcgac
aagggcgtggacgtgtccttcgaatgcaccagcgtgaacaaggtgctggacgccctggtg
gccgcgaccaagcccaccggcgtggtggtgatcgtgtcgatctggagccatccggccacc
atcaacgtgcacagcgtggtgatgaaggagctggacgtgcgcggcaccatcgcctactgc
aacgaccatcgggaaaccatcaagctggtggaacaggggaagatcgacctggagcctttc
atcacccagcgcatccagctggacgacctggtttcacaaggcttcgacaccctgatccac
aacaatgagtcggcggtgaagatcatcgttcagccgcgattgaagtaa

DBGET integrated database retrieval system