KEGG   Thauera humireducens: AC731_018545Help
Entry
AC731_018545      CDS       T04211                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
thu  Thauera humireducens
Pathway
thu00473  D-Alanine metabolism
thu00550  Peptidoglycan biosynthesis
thu01100  Metabolic pathways
thu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:thu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AC731_018545
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AC731_018545
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AC731_018545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thu01011]
    AC731_018545
Enzymes [BR:thu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AC731_018545
Peptidoglycan biosynthesis and degradation proteins [BR:thu01011]
 Precursor biosynthesis
  Amino acid ligase
   AC731_018545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATPgrasp_ST RimK CPSase_L_D2 ATP-grasp_4 TTL
Motif
Other DBs
NCBI-ProteinID: AMO38769
UniProt: A0A127K9Y3
LinkDB All DBs
Position
3992867..3993781
Genome map
AA seq 304 aa AA seqDB search
MKARFGKVAVLFGGSSAEREVSLMSGQAVLAALQGAGVDAHAFDPAERDLHILKEEGFDR
AFIALHGRGGEDGTVQGALELMGIPYTGSGVMASALSMDKWRTKMVWLASGLPTPRYAIL
EADSDWDAVVAELGLPIFVKPVHEGSSMGATKVTEAGQLRAAWELAARYDSLVIAEEFVA
GEELTAPFLEDQALPLVRIVAPDGNYDYQHKYFTDDTRYDCPCGLPAALEAELQALIMKS
ARVLGCRGWGRADLILTADGRPYLLEMNTSPGMTSHSLVPMSARVAGLEFEALCLKILEG
ARLG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgcggtttggcaaggttgcagtcctgttcggcggttcctccgccgagcgcgag
gtgtcgttgatgtccggccaggcggtgctcgctgcgctgcagggcgccggcgtggatgcg
catgctttcgacccggccgaacgggatctgcacatcctcaaggaagagggcttcgatcgt
gccttcatcgcgctgcatggtcgcggcggcgaggacggtacggtgcagggcgcgctggaa
ctgatgggcattccctacaccggcagcggcgtgatggcctcggccctgtcgatggacaag
tggcggacgaagatggtgtggctggccagcgggctgcccacgccgcgttacgccatcctc
gaggccgactccgactgggatgcggtggtcgccgagctggggctgccgatcttcgtcaag
cccgtgcatgaaggctcgagcatgggggcgaccaaggtcaccgaggccggccagctgcgt
gccgcctgggaactcgccgcccgctacgacagcctggtcatcgccgaggaattcgtcgcc
ggcgaggagctgaccgcacccttcctcgaagaccaggcgctgcccctggtgcgcatcgtg
gcgcccgacggcaactacgattaccagcacaagtactttaccgacgacacccgctacgac
tgcccctgcggcctgcctgccgcgctcgaggccgaactccaggcgctgatcatgaagtcg
gctcgcgtgctgggctgccggggctgggggcgtgcggacctgatcctcaccgcggacggc
cgcccctatctgctcgagatgaacacctcgcccggcatgaccagccattcgctggtgccg
atgtcggcgcgtgtggccggtctcgagttcgaggccctgtgcctgaagatcctcgaagga
gcccgccttggctga

DBGET integrated database retrieval system