KEGG   Thermococcus sp. 2319x1: ADU37_CDS08470Help
Entry
ADU37_CDS08470    CDS       T04245                                 

Definition
(GenBank) Tungsten-containing aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
thv  Thermococcus sp. 2319x1
Pathway
thv00030  Pentose phosphate pathway
thv01100  Metabolic pathways
thv01120  Microbial metabolism in diverse environments
thv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ADU37_CDS08470
Enzymes [BR:thv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     ADU37_CDS08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ALV62546
UniProt: A0A0U2Z6J8
LinkDB All DBs
Position
724813..726630
Genome map
AA seq 605 aa AA seqDB search
MFGYMGKILRVNLTTGEIKVEELKEEDAKEFIGGRGLATKILLEEIDPKVDPFSPENKLI
FATGPLTGTTAPTGGRYMVVTKSPLTGFIASSNSGGFFGAELKFAGYDALIVEGKADHPV
YISIKDEDVEIKDASHLWGKRVGETTDKLLEEFGDKKARVACIGPAGEKLVKFANIMNDK
HRAAGRSGVGAVMGSKNLKAVVVRGTKQVELADKEKFMSVVKEKIKKIKENPITGGGLPQ
YGTAVLVNIINENGLYPTNNFQTGVFKYAYEQSGEALAAKYLVRNHPCFACPIGCGRVSY
HPAIGITEGPEYESIWALGATCGINDLASIVIANHLCDEFGLDTISTGGTLAAAMELYER
GIIKQEELGDAPPLRFGNTEVLHYYIEKIAKREGFGDKLAEGSYRLAESYGHPEYSMSVK
KQELPAYDPRGAEGHGVTYATSNRGGCHVRGYMISPEILGVPVKLDPHDVSEEKAKWVKI
FQDLTAVIDSSGLCLFTSFALGADDYSEMLNAATGFEFTTDEWLKAGERVWNIERIFNLK
AGLVPEKDDTLPKRFLEEPMPEGPNKGHVVKLHEILPKYYKLRGWDEKGYPTEEKLKELG
LDKYY
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggtatatgggaaaaatattgagagttaacctaacgacgggagaaataaaagtg
gaagaactgaaggaagaagacgcaaaggagttcatcggcggtagaggccttgcaacaaag
atccttttagaggaaatagatccaaaggttgatccattcagcccggagaataagttaatc
tttgccacggggcccttgaccggaacaactgctccaactggcggtagatacatggtggtt
acaaagtctccgctaacggggttcatagcttcaagcaactcaggtggcttctttggtgca
gagctgaagtttgcgggttatgatgccttgattgttgagggaaaggcagaccatccggtc
tacataagcataaaggacgaagatgtggagatcaaagatgcctcccacctctggggtaaa
agagttggagaaactactgacaagctccttgaagagtttggggacaaaaaggcgagggtt
gcttgtataggccccgctggagagaaacttgtaaagtttgcaaacataatgaacgacaaa
catagagccgctggaagaagtggtgtaggagcagtaatggggagcaagaatttgaaggct
gttgtagttaggggaacaaagcaagtagagctcgccgacaaagaaaagttcatgagcgtc
gttaaggagaagataaagaagataaaggagaacccaattacgggcggaggacttccacag
tatggaaccgcagttctggtaaacataataaatgaaaacggcctttatccaacgaacaat
ttccagactggagtattcaagtatgcctacgagcagagcggtgaggccttagctgcaaag
tacctggtgagaaaccacccatgctttgcatgtccaattggatgtggaagggtctcgtat
cacccggccataggaattaccgaaggtcccgaatacgaaagcatatgggcccttggtgca
acctgtggtataaacgacctggcaagcatagtgatagcgaaccacctatgtgatgagttt
ggccttgatacgatttcaacaggtggaactttagcggcagctatggagctttatgagagg
ggcatcataaagcaggaagagcttggagacgcaccgcccttgagattcggtaacactgaa
gtgctccactactacatcgagaagattgcgaagagagagggctttggggacaaactagct
gaaggaagctaccgcttggctgagagctacgggcatccagaatactcaatgagcgttaaa
aagcaggagctcccggcatatgatcccagaggagcagaaggacacggtgtaacttatgcc
acctccaacagaggtggatgtcacgttagaggttacatgatcagcccagaaatcctcggt
gttcctgtaaagcttgatccccacgacgtaagcgaagagaaggccaagtgggttaagata
ttccaagacttaaccgcagtaattgactcctccggcttgtgcctcttcacgagctttgca
cttggagcagatgattactccgagatgctgaatgccgcaacgggctttgagtttacgact
gatgagtggctcaaggcgggagagagagtatggaacattgagaggatcttcaaccttaaa
gccggtttagtcccagaaaaagacgatactttgcccaagagattcttggaagagccaatg
cctgaaggacccaacaaaggacacgtggtaaaactccacgagatccttccaaaatactac
aagctcaggggctgggacgagaaaggatacccgactgaggagaagctcaaggagcttggt
ttggacaagtattattaa

DBGET integrated database retrieval system