KEGG   Thermococcus sp. 2319x1: ADU37_CDS20180Help
Entry
ADU37_CDS20180    CDS       T04245                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
thv  Thermococcus sp. 2319x1
Pathway
thv00630  Glyoxylate and dicarboxylate metabolism
thv01100  Metabolic pathways
thv01120  Microbial metabolism in diverse environments
thv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ADU37_CDS20180
Enzymes [BR:thv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ADU37_CDS20180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ALV63717
UniProt: A0A0U3SG02
LinkDB All DBs
Position
complement(1720121..1721455)
Genome map
AA seq 444 aa AA seqDB search
MPEKFDKIYDYYVDKGYEPSKKRDIIAVFRITPAEGYTIEQAAGGVAAESSTGTWTTLYP
WYEEERWADLSAKAYDFHDMGDGSWIVKIAYPFHTFEEANLPGLLASIAGNVFGMKRVKG
LRLEDLYLPEKIIREFNGPAFGIEGVRKMLEIKDRPLYGVVPKPKVGYSPEEFEKLAYEL
LSNGADYMKDDENLTSPWYNRFEERAEIMARIIEKVENETGEKKTWFANITADIREMETR
LELLADLGLKHAMVDVVITGWGALEYIRDLAEDYGLAIHGHRAMHATFTRNPYHGISMFV
LAKLYRLIGIDQLHVGTAGAGKLEGGKWDVIQNARILRETHYKPDENDVFHLEQKFYGIR
AAFPTSSGGLHPGNLPAVIEALGTDVVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIA
LEEYAKTHKELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaaagtttgacaagatatatgactactatgtggacaaaggctatgaacccagc
aagaagagggatatcatagccgtttttaggataactccagctgaaggatacactattgag
caagcggccggaggagttgccgcggagagctcaaccggaacctggactaccctctatcca
tggtatgaggaggaaaggtgggcggatctatctgcaaaagcttacgacttccacgacatg
ggggatggcagctggatagttaagatcgcctatccgttccacacttttgaagaagccaat
ttaccgggacttcttgcgagcattgctggaaacgtctttggaatgaaaagagtgaaaggg
ctccgtcttgaggatctctacctgcccgagaaaataatcagagagttcaacggacctgcc
tttggtatagagggagtaagaaagatgcttgaaatcaaagataggcccctctacggtgtg
gttccaaagccaaaggtcggctattcaccggaggagtttgagaagcttgcctatgagctc
ctttcaaacggtgccgactacatgaaggacgatgaaaatcttacaagcccgtggtacaac
cgcttcgaggagagagcagagataatggcgagaataattgaaaaagtcgagaacgaaacc
ggggaaaagaagacgtggttcgccaacattactgcggacataagggaaatggaaaccaga
cttgagctccttgcagaccttggtctcaagcacgcgatggtcgatgttgtcataaccggc
tggggtgctctggaatacataagggatttggctgaagattatggtctcgctatacacggc
cacagggcgatgcacgctaccttcacgaggaacccatatcacggcatctcaatgttcgtc
cttgctaagctctacaggttaataggcatcgaccagctccacgttggaactgctggtgct
ggaaagctcgaaggtggcaagtgggacgttattcaaaacgccagaatcttaagggaaacc
cattacaagcccgatgaaaacgacgtcttccaccttgagcagaagttctacggcataaga
gcagcattcccgaccagctccggtggattacatccgggcaacttgccagcggtcatagag
gctttaggaaccgacgttgtcctccagctcggcgggggaaccctcggtcaccctgacgga
cccgccgctggagcgagggcagtcaggcaggctatagatgccataatgcagggaattgct
ttggaggagtacgcgaagacacacaaggagctcgcaagggcattagaaaagtggggtcac
gtgaccccggtttga

DBGET integrated database retrieval system