KEGG   Thioclava nitratireducens: BMG03_02035Help
Entry
BMG03_02035       CDS       T04697                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
thw  Thioclava nitratireducens
Pathway
thw02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:thw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BMG03_02035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:thw02000]
    BMG03_02035
Enzymes [BR:thw01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     BMG03_02035
Transporters [BR:thw02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    BMG03_02035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 RsgA_GTPase AAA_23 AAA_22 AAA_29 AAA_33 AAA_28 AAA_16 Rad17 AAA_25 AAA_18 AAA_24
Motif
Other DBs
NCBI-ProteinID: AQS46719
LinkDB All DBs
Position
complement(394560..395357)
Genome map
AA seq 265 aa AA seqDB search
MEDMSLTERAVTTDDIKITARNVQVYYGDTHAIKDVNVDILDKTVTAFIGPSGCGKSTFL
RCLNRMNDTIDVARVEGEILLDGEDIYDKRVDPVQLRAKVGMVFQKPNPFPKSIYDNVAY
GPKIHGLTKNKAELDQVVEDSLRKAALWNEVKDRLHAPGTGLSGGQQQRLCIARAVATSP
EVLLMDEPCSALDPIATAQVEELIDELRANFSVVIVTHSMQQAARVSQRTAFFHLGNLVE
YDDTDKIFTNPSDSRTESYITGRIG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatgagcctgacggagagagccgtgaccactgacgacatcaagatcaccgca
cgcaacgtgcaggtctactacggcgacacccacgcgatcaaagacgtcaatgtcgacatc
ctcgacaagactgtcaccgccttcatcggcccatctggctgcgggaaatcgaccttcctg
cgatgcctgaaccgcatgaacgacacgatcgacgtcgcccgcgtcgagggagaaatcctg
ctcgatggcgaggacatctacgacaagcgcgtcgatccggtgcagctgcgcgccaaggtc
ggcatggtgttccagaaaccgaaccccttcccgaaatcgatctacgacaacgtggcctac
ggcccgaaaatccacggcctgaccaaaaacaaggccgagctggatcaggtggtcgaggat
tcgctgcgcaaggccgcgctgtggaacgaagtgaaggatcgcctccacgctcccgggacc
gggctttccggcggccagcaacagcgcctgtgcatcgcgcgcgccgtcgcgacctcgccg
gaagtgctgctgatggacgagccctgctcggcgctcgacccgatcgcgaccgcgcaggtc
gaggaactgatcgacgaacttcgggcgaatttctcggtggtgatcgtgacgcactcgatg
cagcaggccgcgcgcgtcagccagagaaccgcgttcttccacctcgggaatctcgtcgaa
tacgacgatacggacaagatattcaccaacccgtccgacagccggacggaaagctacatt
accggccggatcggctga

DBGET integrated database retrieval system