KEGG   Thioclava nitratireducens: BMG03_06785Help
Entry
BMG03_06785       CDS       T04697                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
thw  Thioclava nitratireducens
Pathway
thw00240  Pyrimidine metabolism
thw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BMG03_06785
Enzymes [BR:thw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BMG03_06785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AQS47537
UniProt: A0A1S6IDU9
LinkDB All DBs
Position
1365906..1366487
Genome map
AA seq 193 aa AA seqDB search
MAKLYFHYSTMNAGKSTILLQASHNYIERGMETFLVTARLDNRAGDGRIASRIGIGAEAA
CFTEETDMFALIEKRLADGPCACIFVDEAQFLTETQVWQIARAVDDLRVPVMCYGLRVDF
QGKLFPGSAALLALADEMREVRTICHCGKKATMVVRMGPDGQALRDGDQVQIGGNETYVS
LCRRHWREAMGEA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctacttccattattccacgatgaacgcgggcaagagcacgatcctcttg
caagcctcccacaactatatcgaacgcgggatggagacgttcctcgtgaccgcgcggctc
gacaatcgcgcgggcgacgggcgcatcgcgagccggatcggcatcggtgcggaggcggcc
tgtttcaccgaagagaccgatatgttcgcgctgatcgagaagcgcttggcggacggcccc
tgcgcctgcatcttcgtggacgaggcgcagttcctgaccgagacgcaggtctggcagatc
gctcgcgcggtcgatgacctgcgcgtgccggtgatgtgctacgggttgcgcgtggatttt
cagggcaagctgttccccggctcggcggcgctgctggcgctcgccgacgagatgcgcgaa
gtccgcacgatctgccattgcggcaagaaggccacgatggtggtgcggatgggcccggac
ggacaggcgctgcgcgatggcgatcaggtgcagatcggtggcaacgagacctatgtcagc
ctctgccgccgtcattggcgcgaggcgatgggagaggcctaa

DBGET integrated database retrieval system