KEGG   Thioclava nitratireducens: BMG03_08960
Entry
BMG03_08960       CDS       T04697                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
thw  Thioclava nitratireducens
Pathway
thw00071  Fatty acid degradation
thw00280  Valine, leucine and isoleucine degradation
thw00281  Geraniol degradation
thw00310  Lysine degradation
thw00360  Phenylalanine metabolism
thw00362  Benzoate degradation
thw00380  Tryptophan metabolism
thw00410  beta-Alanine metabolism
thw00627  Aminobenzoate degradation
thw00640  Propanoate metabolism
thw00650  Butanoate metabolism
thw00903  Limonene and pinene degradation
thw00930  Caprolactam degradation
thw01100  Metabolic pathways
thw01110  Biosynthesis of secondary metabolites
thw01120  Microbial metabolism in diverse environments
thw01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:thw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BMG03_08960
   00650 Butanoate metabolism
    BMG03_08960
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMG03_08960
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMG03_08960
   00310 Lysine degradation
    BMG03_08960
   00360 Phenylalanine metabolism
    BMG03_08960
   00380 Tryptophan metabolism
    BMG03_08960
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMG03_08960
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BMG03_08960
   00281 Geraniol degradation
    BMG03_08960
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMG03_08960
   00627 Aminobenzoate degradation
    BMG03_08960
   00930 Caprolactam degradation
    BMG03_08960
Enzymes [BR:thw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BMG03_08960
SSDB
Motif
Pfam: ECH_2 ECH_1
Other DBs
NCBI-ProteinID: AQS47924
LinkDB
Position
complement(1860192..1861238)
AA seq 348 aa
MTEETMIARKEGHAGRLTFNRPKALNALDHEMAMAIEAALDAWRDDPEVDLVVIDAAGDR
AFCSGGDIAAVYRAGIAGDYAPGRDFWRDEYRMNAKIAEYPKPIVAFMQGFVMGGGVGVG
GHASHRIVGESTQVAMPESGIGLIPDVGGTLLLARAPGHVGEYLGLTGARMNATDALYAG
FADMFVPEADWEELKTRLIETGNIDTLPHPRTPPEPGKLEGLRPEIDRIFWAENLSAIVA
KLETSGSEFAEKTYKTVLRNSALSMEATLRLIRMTRAENTIRAALTHEFRFTWRAAELGD
FLEGVRAQIIDKDRNPQWKYALDALPEEAVAQMLEPLGPEWAIWEETT
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgaccgaagaaacgatgatcgcgagaaaggaaggccacgccggacggctgaccttcaat
cgacccaaggcgctcaacgcgctcgatcacgagatggccatggcgatcgaggcggcgctc
gacgcatggcgcgacgacccggaggtcgatcttgtcgtgatcgacgcagcgggtgatcgc
gccttctgctcgggcggcgacatcgccgccgtctaccgggccgggatcgctggcgattat
gcaccgggacgcgacttctggcgcgacgaataccggatgaacgcaaagatcgcggaatat
cccaagcccatcgtcgccttcatgcagggcttcgtgatgggcggcggcgtcggcgtcggc
ggccatgccagccaccggatcgtgggcgaaagcacgcaggtcgcgatgccggaaagcggg
atcgggctgatcccggacgtgggcggcacgcttttgctggcgcgcgcgccaggccacgtg
ggcgaatatctcggcctcacgggggcgcgaatgaacgcaaccgacgcgctctatgccggg
ttcgccgatatgttcgtgcccgaggccgattgggaggagttgaagacccggctcatcgag
accggcaatatcgacaccctgccccatccgcgcaccccgcccgaacccggcaagctggag
ggcctgcgccccgagatcgaccgcatcttctgggccgagaacctcagcgcgatcgtcgcc
aagctcgagacttcgggcagcgagttcgccgagaagacctacaagacggtgctgcgcaac
tccgcgctgtcgatggaggcgacgctgcgcctgatccgcatgacccgcgccgagaacacg
atccgcgccgccctcacccatgagttccgctttacctggcgtgcggcggagctaggtgat
tttcttgagggcgtgcgggcgcagatcatcgacaaggatcgcaatccgcaatggaaatat
gctctggatgcgctgccggaagaggcggtcgcgcagatgctggagccgctcggccccgaa
tgggccatctgggaggagacgacatga

DBGET integrated database retrieval system