KEGG   Thioclava nitratireducens: BMG03_14010Help
Entry
BMG03_14010       CDS       T04697                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
thw  Thioclava nitratireducens
Pathway
thw00473  D-Alanine metabolism
thw00550  Peptidoglycan biosynthesis
thw01100  Metabolic pathways
thw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:thw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BMG03_14010
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BMG03_14010
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BMG03_14010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thw01011]
    BMG03_14010
Enzymes [BR:thw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BMG03_14010
Peptidoglycan biosynthesis and degradation proteins [BR:thw01011]
 Precursor biosynthesis
  Amino acid ligase
   BMG03_14010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 ComA
Motif
Other DBs
NCBI-ProteinID: AQS48784
UniProt: A0A1S6IGV6
LinkDB All DBs
Position
complement(2923355..2924269)
Genome map
AA seq 304 aa AA seqDB search
MSSRASHRVAVLLGGPSAEREVSLSSGRECAKALRTAGFEVIEIDAGEDLPQRLNDAAPD
CVFNALHGRWGEDGCVQGMLEWLRIPYTHSGVLASALAMDKARAKQAYAAANLPIVQSVI
ASRGDVMARHVLPAPYVVKPNNEGSSVGVYLVMDGANSPPQLSAEMPEEVMVETYAPGRE
LTVSVMGERALCVTEIITEGWYDYDAKYRPGGSRHVLPAEIPVEITEACLDYAIRAHQVL
GCRGLSRTDFRWDEGRGLAGLVLLETNTQPGMTPTSLSPEQAAHCGIDFPELCAWLVEDA
SCGR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcagggcatcccaccgtgtggcggttcttctgggcggcccttctgctgagcgg
gaggtgtctctgtcctcggggcgcgaatgcgccaaggcattgcgcacggcgggtttcgaa
gtgatcgagatcgacgcgggagaggatcttccgcaacggctgaacgatgccgcgcctgac
tgtgttttcaatgctttgcacgggcgctggggcgaagatggctgcgttcagggcatgctc
gaatggctccgtatcccctatactcattccggcgttctggcctctgcgctggccatggac
aaggcccgcgccaagcaggcctatgccgccgcgaacctgcccatcgtgcaatcggtgatc
gcctccaggggggacgtgatggcgcggcacgtgctgcccgcgccctacgtcgtgaagccg
aataacgaaggatcgtccgtcggcgtctacctggtgatggacggcgcgaattctccgccg
cagctgtcggccgagatgcccgaagaggtgatggtcgagacctacgccccgggccgcgaa
ttgaccgtttccgtgatgggcgagcgcgcgctctgcgtgaccgaaatcatcaccgagggc
tggtacgactatgacgcgaaataccgccccggcggatcgcgtcacgtccttcccgccgaa
atccccgtcgagatcaccgaagcctgcctcgattacgcaattcgcgcacatcaggtgctg
ggctgccgggggctctcgcgcaccgatttccgctgggacgagggcagggggctcgccggt
ctcgtgctgctggaaaccaacacccagcccggcatgacgcccacctcgctttcgcccgaa
caggcggcccattgcggcatcgacttcccggagctttgcgcctggttggtggaggacgcc
tcatgcggccgctga

DBGET integrated database retrieval system