KEGG   Thermoanaerobacter sp. X513: Thet_0511Help
Entry
Thet_0511         CDS       T01317                                 

Definition
(GenBank) flagellar protein FlaG protein
  KO
K06603  flagellar protein FlaG
Organism
thx  Thermoanaerobacter sp. X513
Brite
KEGG Orthology (KO) [BR:thx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:thx02035]
    Thet_0511
Bacterial motility proteins [BR:thx02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    Thet_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlaG AIB
Motif
Other DBs
NCBI-ProteinID: ADN54160
LinkDB All DBs
Position
516567..516914
Genome map
AA seq 115 aa AA seqDB search
MAMLQGINTARTGHVNSQFRKDSGLLEEIKVVKDILSKPVDDDKLNSALNKENRKISIND
HTYFEFSVHKPTNTIMVKIVDSDTNEVIDEIPPEKILDLVAGLWKIAGLFVDRKI
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgttgcaggggattaatactgcgagaacaggacatgtgaattcgcagtttaga
aaggatagtgggctattagaggaaataaaagtagtaaaagatatacttagtaaacctgtg
gatgatgacaaacttaacagtgcacttaataaagaaaatagaaaaataagcattaacgat
catacatattttgaattttctgtacacaagcctacaaatacaataatggtcaaaattgtt
gatagcgatacgaatgaagttattgacgagattcctcctgaaaaaatacttgaccttgtg
gcaggattatggaaaatagctggactttttgtggatagaaaaatatag

DBGET integrated database retrieval system