KEGG   Thermoanaerobacter sp. X513: Thet_1151Help
Entry
Thet_1151         CDS       T01317                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
thx  Thermoanaerobacter sp. X513
Brite
KEGG Orthology (KO) [BR:thx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:thx01001]
    Thet_1151
Enzymes [BR:thx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Thet_1151
Protein kinases [BR:thx01001]
 Serine/threonine kinases: Other
  Bacterial family
   Thet_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH ETRAMP Pkinase_fungal ABC1 RIO1 Kinase-like FTA2 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ADN54754
LinkDB All DBs
Position
1160475..1162352
Genome map
AA seq 625 aa AA seqDB search
MIGRILGNRYEILEKIGAGGMAKVYKAKCHLLNRIVAIKILRPEFAADEDFVKKFRRESQ
AAASLSHPNIVSIYDVGQEGDIYYIVMEYVKGRTLKKLISENGGPLEVGRAIEIARQVCK
ALDHAHKNRIIHRDIKPQNILVTDDDVVKVTDFGIARAANGSTITYTGDVVGTAYYFSPE
QARGGIVDERTDIYSLGIVLYEMLTGKVPFEGDSPISVALKHIQEDIIPPSKLNDKVPKE
LDQIVLKATQKDVNLRYQTAADFLKDLDVFLRNPKELNFKEEENTKTRVIPSKDVEELKR
AAQRKEKEKKRRNVIKRIATVLLILLLLASLSYGTIYVLNNFFKVSDVVVPNVVGLSLNQ
ASKILSDHNLKMEISEERYSDKPENTILSQDPPQGSVVKTGTTVYVVISKGTQVVVVPNV
INKDYLEAKNILENMGLKANIIEQYNDQFPRGYVFDQNPRQGVQVEYNTVIDLYVSKGQQ
PAIMPNVVNMTLEEATTALENAGLKLGKVIYKETTDVPENVVLEQSVPPNSEVQKGSPID
LIVSKMPQDSLQQRTKNVIIELPNKPGTMKVDVYVIQNEQKNLVYSDEHTYQESPLTVPV
TAYKGKATIEVDIDGEVYSTVEARF
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgattggacgtatattaggtaaccgatatgaaatattagagaaaattggcgcaggggga
atggctaaggtttacaaagcaaagtgtcatctccttaacagaatagtggcaatcaaaatt
ttgaggcctgaatttgcagcagatgaggattttgtgaaaaaatttagaagagagtctcag
gcagcggcaagtctttctcatcctaatatagtgagtatatacgatgttgggcaagaagga
gatatttactacattgtgatggaatatgtaaagggacgtactttaaaaaagcttataagt
gaaaatggaggaccgttagaagtaggtagagcaatagaaatagcacgacaagtttgtaaa
gccctggatcacgcccataaaaatcgaataattcacagagatataaaacctcaaaatatt
cttgttactgacgacgatgtggtgaaagttactgattttggaattgcacgagctgctaat
ggttctactataacttacaccggagatgtggtaggaactgcttattatttttcgcctgaa
caggcaaggggtggaatagtagatgaaaggacggatatttactctttaggaattgtcctt
tatgaaatgttaacaggaaaagtgccttttgagggagacagtcctatttctgtcgcttta
aaacacattcaagaagatataattcctccttcaaagctaaatgacaaagtaccaaaagaa
ttagatcaaatagttttaaaagctactcaaaaagatgtaaatctaaggtatcaaactgca
gcagattttcttaaggacctagatgtttttttgcgaaaccctaaagaactaaacttcaaa
gaagaggaaaacacaaaaacacgggtgattccttctaaagatgtagaagagttaaagaga
gcggcacaaagaaaggagaaagaaaagaaaaggcgaaacgtcataaagagaatagcaact
gttttattaattctcttgctactggcttctttgtcttatggtaccatatacgtcctcaat
aacttttttaaagtgagcgatgttgtggttccaaatgttgttggtttgtccttaaaccaa
gcaagtaaaattctatcagaccataatttaaagatggagataagtgaagagcggtatagc
gataaacctgaaaatactattttatctcaagaccctccacaagggagtgtagtaaaaact
ggaactacagtttatgtagtgattagtaaaggtacgcaagttgttgtggtgcctaatgtt
ataaacaaagattatttagaggctaaaaatattcttgagaatatgggcctcaaagcaaat
attatagaacaatacaatgaccagtttcctagaggatatgtttttgaccaaaatccaaga
caaggagtacaggtagaatataacacagtgattgatctgtatgttagcaaaggtcaacag
ccggcaataatgcccaacgtagttaatatgacattggaggaagcaacaactgccttagaa
aatgctggtttaaaattaggtaaagtcatttataaagagacaactgatgtgccagaaaat
gtagttttagagcaaagtgttcctccaaacagtgaggttcaaaagggaagtccgatagat
ttaattgtcagcaagatgcctcaagattctttacaacaacgaactaaaaatgttattatt
gaattgcccaacaaaccgggtactatgaaagtggatgtatatgtaatacaaaatgagcaa
aagaatttagtatattctgatgaacacacttatcaagaaagcccccttactgttcctgta
acggcatataaaggtaaagctacaattgaggtggatatagatggagaagtgtatagtaca
gtggaggcgagattttaa

DBGET integrated database retrieval system