KEGG   Thermoanaerobacter sp. X513: Thet_1716Help
Entry
Thet_1716         CDS       T01317                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00010  Glycolysis / Gluconeogenesis
thx00030  Pentose phosphate pathway
thx00051  Fructose and mannose metabolism
thx00052  Galactose metabolism
thx00680  Methane metabolism
thx01100  Metabolic pathways
thx01110  Biosynthesis of secondary metabolites
thx01120  Microbial metabolism in diverse environments
thx01130  Biosynthesis of antibiotics
thx01200  Carbon metabolism
thx01230  Biosynthesis of amino acids
thx03018  RNA degradation
Module
thx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:thx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thet_1716
   00030 Pentose phosphate pathway
    Thet_1716
   00051 Fructose and mannose metabolism
    Thet_1716
   00052 Galactose metabolism
    Thet_1716
  09102 Energy metabolism
   00680 Methane metabolism
    Thet_1716
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Thet_1716
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:thx01009]
    Thet_1716
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:thx03019]
    Thet_1716
Enzymes [BR:thx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Thet_1716
Protein phosphatases and associated proteins [BR:thx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Thet_1716
Messenger RNA biogenesis [BR:thx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Thet_1716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADN55297
LinkDB All DBs
Position
complement(1681454..1682419)
Genome map
AA seq 321 aa AA seqDB search
MKTIGILTSGGDAPGMNAAIRAVVRTGIYYGLKVKGIMRGYAGLVEDEVIDLNLSSVGDI
LQKGGTILRTARCEEFKKKEVRKKAYETLQKHGIEGLVVIGGDGSFRGAQLLSEEWNVNT
IGIPGTIDNDIPCTDYTIGFDTACNTVIDAINKIRDTATSHERANIIEVMGRNAGYIALY
AGLAGGAEMIILPEVEWSIDELCDKITYGIKRGKLHHIIVLAEGVMSAPELAKMIKERLP
KLDLRYTILGHIQRGGAPTVMDRVLASQMGARAVELLLENKTKRIISIRNNQIVDDDIDE
ALSMKKEFNRKLYELSKILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgattggtatacttacaagtggtggagatgcaccagggatgaacgcagctata
agggctgtggtaaggacaggaatttattatgggcttaaagtaaaaggtattatgagggga
tatgcaggcttagtagaggatgaagttattgatttaaatctttcttcagtaggagatata
ttgcaaaaaggcggtactattttgagaactgctagatgtgaagaatttaagaaaaaagag
gtgcgcaaaaaagcttacgaaacccttcaaaaacatggaatagaaggtctcgttgtaatt
ggaggagatggctcttttagaggagcacagcttttgagtgaagaatggaatgtaaataca
attggaattccaggtacaattgacaatgacataccttgtacagattatacaataggtttt
gatacagcttgtaatactgttattgatgcaataaataaaataagggatactgctacttcc
catgagagagcaaatataatagaagtgatgggaagaaatgcgggttacattgctttgtat
gctggtctagctggtggagcggagatgattatacttcctgaagtggaatggagcatcgat
gaactttgcgataaaattacttacgggataaagagaggaaagcttcatcatataattgtc
cttgcagaaggagttatgagcgctccagaactagcgaaaatgattaaagaaaggctacca
aaattggacttaaggtatactattttggggcacattcaaagaggtggagctcctacagtg
atggatagggtattggcaagccaaatgggagcaagagcagtggagttgcttttagaaaat
aaaaccaagaggataataagtatacgaaacaatcaaattgtagacgatgatatagatgaa
gccctttccatgaaaaaggagtttaacagaaaactttatgagctcagcaagatattgtct
atataa

DBGET integrated database retrieval system