KEGG   Thermoanaerobacter sp. X513: Thet_1953Help
Entry
Thet_1953         CDS       T01317                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00473  D-Alanine metabolism
thx01100  Metabolic pathways
thx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:thx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Thet_1953
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Thet_1953
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thx01011]
    Thet_1953
Enzymes [BR:thx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Thet_1953
Peptidoglycan biosynthesis and degradation proteins [BR:thx01011]
 Precursor biosynthesis
  Racemase
   Thet_1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADN55518
LinkDB All DBs
Position
complement(1927989..1929155)
Genome map
AA seq 388 aa AA seqDB search
MFDNIRPTRAEIYLDNIVHNLSEVKRWVGKKVKIMGVVKANAYGHGACQVAKVLIENGVS
YLGVATIEEALELRECGINIPILVFGYTPLPQAKELIVHNITQTVFDINYVKDLERIALN
VGKKAKVHVKVDTGMGRIGYTDLNVAEKEIEKMMEMEGVEVEGIFSHFATSDEKDKTYAE
QQFDMFKKLLESLKQKEINIPLKHIANSGAIIDLKYTYLDMVRPGIVLYGSYPSENVERP
LDLRQTMGFKTKIVYIKEVPEGTSISYGRTFITKRKSKIATLPVGYADGFNRLLSNNHHV
LVKGKYAPVIGRICMDQTMLDVTDIEGVEVGDDVTIFGNQDGEKITAEEIAKKLNTIPYE
VYCGISRRVPRIYIYKGEVIEVKNYLKI
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataatataaggccaacaagagcagaaatatatttggataatatagtgcataat
ttgagtgaagtaaagagatgggtggggaagaaagtaaaaataatgggggtagtgaaagcc
aatgcttatggtcatggagcttgtcaagtagcaaaggttttaatagaaaatggggtttct
tatttgggagtagctacaatagaagaggcgttagaattaagggaatgcggaattaatatt
cccatactcgtttttggatatacgcctttacctcaggccaaagaattaattgtgcacaat
ataactcaaactgtttttgatataaactatgttaaagacttagaaagaattgccttaaat
gtgggtaagaaggctaaagttcatgtaaaagttgatacaggtatgggacggataggatat
acagatttaaatgtagctgaaaaagagatagaaaaaatgatggaaatggaaggggtagag
gtagaaggcatatttagtcattttgctacttctgatgaaaaagataaaacatatgctgaa
caacagtttgatatgttcaagaaattgttagaaagcttaaagcaaaaagagataaacatt
cctttaaagcatatagctaacagtggagcaattattgaccttaaatatacttatttagac
atggtaaggccaggaatagttctatacggtagttatccttcagaaaatgttgaaagacca
ttggatttaagacagactatgggttttaaaactaaaatagtgtatataaaagaagtacct
gaaggtacttccattagttatggaaggacatttataactaaaagaaaaagcaaaattgcc
acattgcctgtaggatatgctgatggttttaatagattactctctaataatcatcatgtc
ttagtaaaagggaaatatgctcccgtaattgggagaatttgtatggaccaaacgatgtta
gatgtcaccgatatagaaggagtagaagtaggtgatgatgtaactatttttggaaatcaa
gatggagaaaaaataacagcagaggagattgctaaaaaattaaatactataccttatgaa
gtatattgtggaatatctagaagggtacctcgaatatatatttacaaaggagaggtaatt
gaggtaaaaaattatttaaaaatttga

DBGET integrated database retrieval system