KEGG   Thermoanaerobacter sp. X513: Thet_2137Help
Entry
Thet_2137         CDS       T01317                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00260  Glycine, serine and threonine metabolism
thx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thet_2137
Enzymes [BR:thx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Thet_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C ADH_N_2 FAD_binding_3 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ADN55701
LinkDB All DBs
Position
2103358..2104404
Genome map
AA seq 348 aa AA seqDB search
MVEGYMTAVVKQHTTEGADIIKKEIPIIGPDEVLIKVKATSICGTDVHIYVWNEWAKSRI
KPPKTMGHEFVGEVVEIGKNVTSVKVGDLVSAETHIVCGKCKACRTGNAHICENTLILGV
DTDGAFAEYIKVPESNVWLNDKDIPLELLSIQEPLGNAVHTVFSGEVVGKTVAVVGCGPI
GMMAIPLLKTTGASAVFAIEPVEYRRELAHKLGATRVINPLKEDVVSIIKSETEGYGADV
VLDFSGSSIAIRQGLKYIAKGGRMSILGLPDNEVPIDITNDVIFKGITIHGITGRRMYDT
WYQVKGLLRSGLKDALKPIITHTFPLTEYQKGMELMIKGQCGKVVLYP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaggatatatgaccgctgttgttaaacaacataccacagagggtgcagatata
ataaaaaaagaaataccaataataggaccggatgaagtcttaataaaagtcaaagctaca
tctatttgcggcacagacgttcacatttacgtttggaatgaatgggcaaaaagccgcata
aaacctccaaagacaatgggacatgaatttgtaggagaagttgtagaaataggtaaaaat
gtaacatctgtaaaggttggagatttagtaagtgcggaaactcacatagtatgtggaaaa
tgcaaagcttgcagaacaggtaatgcccacatctgcgaaaacaccctcatactcggtgtt
gatacagacggtgcttttgcagaatacattaaagtcccggaaagcaatgtatggctaaac
gataaagacatacctttagaacttctctccatacaagaaccccttggaaacgccgttcac
acagtattttctggagaggtagtaggaaaaactgtcgctgtagtaggttgcggtcctata
ggtatgatggcgataccacttcttaaaacaacaggagcttcagctgtatttgcaatagaa
cctgtcgaatacagaagggaacttgctcataaattaggtgcaacacgagttataaaccct
cttaaagaagacgttgtcagtataataaaaagcgaaacagaaggctacggcgcggatgta
gtattggacttctctggaagctcgattgcaataaggcaaggtcttaaatatatcgcaaaa
ggcggaagaatgtctattttaggtcttcctgacaatgaagtccctatagacataaccaat
gatgtcatttttaaaggcataactatacacggcatcacaggaaggcgaatgtacgatact
tggtaccaagtaaaaggtttattgcgctcaggattaaaagatgcattaaagccaataatc
acccataccttccctctcactgaataccaaaaagggatggaactaatgataaaaggccaa
tgtggcaaagttgtattatatccataa

DBGET integrated database retrieval system