KEGG   Thermococcus sp. P6: A3L12_06060Help
Entry
A3L12_06060       CDS       T05739                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
thy  Thermococcus sp. P6
Pathway
thy00260  Glycine, serine and threonine metabolism
thy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A3L12_06060 (tdh)
Enzymes [BR:thy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     A3L12_06060 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ASJ10894
UniProt: A0A218PDF1
LinkDB All DBs
Position
1122893..1123945
Genome map
AA seq 350 aa AA seqDB search
MAEKMEAIMKTRPAYGAELVEVDVPEPGPGEVLIKVLATTICGTDLHIYEWNEWAQSRIK
PPQIMGHEVAGEVVEVGPGVDDIEVGDYISAETHIVCGRCYACRHNRYHVCQNTKIFGVD
MDGVFAEYAIVPARNAWKNPRNMKPEHAALQEPLGNAVDTVLAGPIAGRSTLITGAGPLG
LLGITVAKASGAYPVIVSEPSDFRRELARKVGADYVVNPFEEDPVKFVMDVTDGAGVEVF
LEFSGAPKALEQGLKATTPGGRVSLLGLYPRDVTLDVNNLIIFKALEVHGITGRHLWETW
YTVSSLIQSGKLNLDPIITHRYKGFEKFEEAFELMRAGKTGKVVFFPHRG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagatggaagccattatgaaaacccggcccgcttacggcgccgagctcgtt
gaggtcgacgttccggaacccggccccggggaagttctcatcaaagttctcgcaaccaca
atctgcgggacggatctccacatttacgagtggaacgagtgggcccagagcaggatcaag
cccccccagataatggggcatgaggtcgcgggagaggtcgtagaagtcggccctggtgtg
gatgatatcgaggttggggattacataagcgccgagactcacatcgtctgcggcaggtgc
tacgcctgcaggcacaaccgctaccacgtctgccagaacacgaagatattcggtgtggat
atggacggcgtctttgcggagtacgctatagttccagcccggaacgcctggaagaacccc
cggaacatgaagccggaacatgcggcccttcaggagccccttggaaacgccgttgacacc
gtgctggccggtccaatagcggggaggagcaccctgattaccggtgccggacctctcggg
cttctcgggataacggttgccaaggcatcgggagcctacccggtcatagtgagcgaaccg
agcgatttcaggagggaacttgccagaaaggtcggtgccgattacgtcgttaacccattc
gaggaggatccggttaagttcgtgatggatgtcacagacggagccggcgttgaggtgttc
ctcgagttcagcggcgccccgaaggcgcttgaacagggtttaaaggccaccacgcccgga
gggagggtttccctgctcgggctctacccgcgcgacgttacccttgacgtcaacaacctc
atcatattcaaggccctcgaggttcacgggataaccggaaggcacctctgggagacgtgg
tacaccgtgtcgagcctcattcagagcggaaagttaaacctcgaccctataatcacccac
aggtacaaaggctttgagaagtttgaagaggccttcgagttgatgagggccgggaagacc
gggaaggtcgtcttcttcccccacaggggctga

DBGET integrated database retrieval system