KEGG   Thermococcus sp. P6: A3L12_07450Help
Entry
A3L12_07450       CDS       T05739                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
thy  Thermococcus sp. P6
Pathway
thy00030  Pentose phosphate pathway
thy01100  Metabolic pathways
thy01120  Microbial metabolism in diverse environments
thy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A3L12_07450
Enzymes [BR:thy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     A3L12_07450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ASJ11144
UniProt: A0A218PE48
LinkDB All DBs
Position
1385878..1387695
Genome map
AA seq 605 aa AA seqDB search
MYGNWGKFLRVNLSTGEVKVEEYDEELAKKWLGSRGLAIYLLLKEMDPKVDPLSPENKLI
ISPGPLSGTSAPTGGRYNVVTKSPATGFITMSNSGGYFGAELKFAGYDAIVIEGKAENPV
YIYIKDENVEIRDASHLWGKLVSETEETLRKEIGGKKLRIASIGPAGENLVKFAAVMNDG
HRAAARAGVGAVMGSKNLKAIAVEGSKTVPIADRHKFMLTIREKINKLRNDPVAGGGLPK
YGTAVLVNIINENGLYPTRNFQTGVYEYAEEQSGEAMAAKYLIRNQPCYACPIGCGRVNK
LPTGGVTEGPEYESTWAFGANLGINDLASIIEANHMCDELGLDTISTGGTLATAMELYEK
GILKDEDLGDAPPFRWGNTEVLHYYIEKIARREGFGDKLAEGGYRLAESYGHPEYSMSVK
KLELPAYDPRGAEGHGLGYATNNRGGCHIKNYMISPEILGYPYKMDPHDVSDDKIRMLLL
FQDLTAIIDAAGLCVFTTFGLGPDDYRDMLNAALGWDFSTEEYLKIGERIWNAERIFNLK
AGLDPAKDDTLPKRFLEEPMPEGPNKGYVVRLKEMLPRYYRMRGWTEDGRVTKEKAEELG
IAEFL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggcaactggggaaagtttctacgtgttaacctctccacgggagaggtgaaggtc
gaggagtacgatgaggagcttgccaaaaagtggcttgggagcaggggactggccatatac
ctcctccttaaggagatggacccgaaggtcgacccccttagcccggagaacaagctgata
atatctcccggcccgctgagcgggacgagcgccccgacaggtggaaggtacaacgttgtt
acgaagagcccggccacaggtttcataaccatgtccaactccggaggatacttcggcgcc
gaactcaagttcgctggctacgatgcgatagtgatcgagggcaaagcagagaatcccgtt
tacatctacataaaggacgagaacgtcgaaatccgtgatgcgagtcacctctggggcaag
ctcgtgagcgagactgaggagaccctgagaaaggagataggaggcaagaagctcaggata
gcctccataggcccggcgggagagaacctcgttaagttcgctgccgttatgaacgatggg
cacagggccgcggcaagggccggtgttggagccgtaatgggaagcaagaacctcaaggct
atagccgttgagggaagcaagaccgtaccaatagcggacaggcataagttcatgctaacg
atcagagagaagataaacaagctcagaaacgatcccgtggccgggggagggctgccgaaa
tacggtaccgccgttctggtcaacataatcaacgaaaacggtctttatccaacgaggaac
ttccagacgggagtttacgagtacgccgaagaacagagcggtgaggcgatggcggcaaag
tatctgatcaggaaccagccgtgctacgcctgtccgataggctgtggcagggtgaacaaa
ctcccaacgggtggcgttacggaaggacccgagtacgagagcacatgggcctttggagcg
aacctcggcataaacgacctcgcaagcataatagaggcaaaccacatgtgcgacgagctc
gggctcgacaccatctcaacaggtggaaccctcgcaacggccatggagctctatgagaag
ggaatcctaaaggatgaggacctcggggacgctccgcccttcagatggggcaacacggag
gttctccactactacatcgagaagatcgcaaggagagagggcttcggtgacaagctcgct
gagggcggataccgccttgcagagagctacggccatccggagtactccatgagcgtcaag
aagcttgaacttccagcttacgatccgaggggagccgagggacacggccttggttatgca
acgaacaaccgcggtggctgccacataaagaactacatgataagcccggagatactcggc
tatccctacaagatggatccgcacgatgtaagcgacgataagatcaggatgttactcctc
ttccaggatctcaccgccataattgacgcggccggtctgtgcgtcttcacgaccttcggt
ctcggacccgatgattaccgcgacatgctcaacgcggccctcggttgggacttctcaacg
gaggagtacctcaagataggagagcgtatctggaacgccgagcgcatctttaacctcaag
gccggccttgaccctgctaaggacgatacactgccaaagcgcttcctcgaggagcccatg
cccgagggaccgaacaagggatacgtggtcaggctcaaggagatgctgccccgctactac
aggatgcgcggctggacggaggacggaagggttacaaaggagaaggccgaggagctcggg
atcgctgagttcctttga

DBGET integrated database retrieval system