KEGG   Thermodesulfatator indicus: Thein_0777Help
Entry
Thein_0777        CDS       T01546                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
tid  Thermodesulfatator indicus
Brite
Enzymes [BR:tid01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Thein_0777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M Heme_oxygenase
Motif
Other DBs
NCBI-ProteinID: AEH44655
UniProt: F8ACF4
LinkDB All DBs
Position
complement(812513..813685)
Genome map
AA seq 390 aa AA seqDB search
MIEEEFKKQTELLREVYQALRPLRKVRLEDLEKALEQSKLLFIEGLKKPAFRFRREFRGF
PAGTVIGPGLLMPGFPSIPRVFVLKTGIPRYIYGPFYAEEKIEGYNVRLANVFGEIKAFT
RRGYVCPFATDRWPDFLPMLPEFFEKYPRYVICCEVAGPENPFVSEWPPYIKEDVAFFVF
DIFDLERQKFLAPEKKYALLREYEFRTPEISGPYSPQEIDPLKGLILRYEEEGREGVVLK
PVSFKDGRVIKYVTSSSNVSDLRVAFPYIGELDASYIVHRLVRMTITRWELDQPFDENFY
QALGEAFFGEMKELLDKVAQGEPVEEVFKVRLRRKESLEALMAHFRTAQVRIEIRREEWK
DEYLHVEFAKIYPKATSFWAGKLQGLAQID
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagaagagttcaaaaaacagactgagcttttgcgtgaagtttatcaagccctg
agaccccttcgcaaagtcaggttagaagacctggagaaggccttagagcagagcaagctt
ctttttattgagggcttaaagaagccagcctttcgtttcaggagagagtttcgggggttt
ccggcgggaacggtaattggcccaggtcttcttatgccgggttttcccagtatccccagg
gtgtttgtgcttaaaaccggcattccgcgctatatttacggtcctttctacgccgaggaa
aagatagaaggctacaatgttaggctggccaatgtttttggcgagataaaggccttcacc
cgccgtggctacgtgtgcccttttgccaccgaccgctggcctgattttttacccatgctt
cccgagttctttgaaaaatatcctcgttatgtaatctgctgcgaagtagcaggcccggaa
aatccctttgtgtctgaatggccgccctacataaaagaagacgtggccttctttgtgttt
gatatctttgatcttgaaaggcaaaagttccttgcgccagaaaaaaaatatgcccttttg
cgagaatatgaattcaggactccggaaataagcgggccgtatagtccacaggagattgat
cctttaaaaggacttattctccgctacgaagaggaaggccgggagggcgtagttttaaaa
cccgtgtcctttaaagacggccgggttataaagtatgttacctcgtcttcaaatgtttct
gacctgcgggtggcctttccctatattggcgagcttgacgccagctacatcgttcatcgt
ctggtgcgcatgactatcacccgctgggaattagaccagccctttgacgagaatttttat
caagcgcttggagaggcctttttcggtgagatgaaagaacttctagacaaagtagcccag
ggcgaaccagtagaggaggtcttcaaggtgcgtttgcgccgtaaagaatcccttgaagcc
cttatggcccactttcgcaccgcgcaggtgcgtattgaaatccgccgtgaggaatggaaa
gacgagtatctccatgtagagtttgccaagatttatcccaaggccacttctttctgggcc
gggaagctccagggccttgcccagatagattag

DBGET integrated database retrieval system