KEGG   Thermodesulfatator indicus: Thein_0954Help
Entry
Thein_0954        CDS       T01546                                 

Definition
(GenBank) peptidase M20
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00220  Arginine biosynthesis
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01130  Biosynthesis of antibiotics
tid01210  2-Oxocarboxylic acid metabolism
tid01230  Biosynthesis of amino acids
Module
tid_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:tid00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Thein_0954
Enzymes [BR:tid01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     Thein_0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEH44828
UniProt: F8AD94
LinkDB All DBs
Position
1005827..1006906
Genome map
AA seq 359 aa AA seqDB search
MDLKNRFKELIFTLASIPSPSGEERAILEYLWGRLSQMNIPLRKQEVPDRFWNIIVNESP
ENKLLITTHVDTVPPWLGVFPPRMGDGHLEGLGVCDDKAGVAIMLMLLEERLRQGKPIPA
TFAFVVDEEREGQGSAMLAREPLPPYAVVLEPTDLKIAIAEGGSVEFEIRVKGKAVHGSC
IPHGENAIERAIELVSKLKRLSFLYTEHPLVGPGGFNVERFTGGDGELRVPDQCIVEIDF
RVLPGQETQDVINEIKQILDETPNVHYVIKDISEPFAISTESPIVKKMCEAYRRALKEEP
ELSGMPSWTDAAHLFAAGVEPVVFGPGDLSRCHTPEEIIELVDVVEAFLVLDSLLDIWS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggacctaaaaaatcgtttcaaagaacttatttttacgttggcttcaatcccgagccca
agtggcgaagaacgggccatcctagagtatctctggggtcgcctttctcaaatgaatatt
cctttacgcaaacaagaggtacctgaccgtttctggaatatcattgtaaacgaatcccct
gagaacaagttgctcatcaccacccatgtggatacggttcctccctggctgggggttttt
cctcctcgcatgggagatggccatttagaaggcctgggagtatgtgatgacaaggccggc
gtggccattatgctcatgctccttgaagaaaggcttaggcaaggaaagcctattccggct
acttttgccttcgtggtggatgaagaaagagaaggccagggctcggccatgctggctagg
gagcctttgcctccttacgccgtcgtgcttgagcccacggacttgaaaatagctattgct
gaaggcggctcggtagagtttgaaattcgggtcaaaggaaaagctgtccacggaagctgc
atcccccacggagaaaatgccattgagcgggccatagagctcgtaagcaaactcaaaagg
ctttctttcctatacacagagcatcccctggtaggcccggggggtttcaatgtagaaaga
tttaccggtggagacggtgaactcagagtgccagatcagtgtatagtggagatagacttt
cgcgtcttgcccggccaggaaacccaggatgttatcaacgagattaaacaaattttagat
gagactcccaatgttcattacgtaataaaagacatatctgaaccctttgccatttctact
gaatcacccattgtgaaaaaaatgtgtgaggcctatcgccgggccttaaaggaagagcct
gagctttccggtatgcccagctggacagatgcggctcatctttttgctgctggtgttgaa
ccggtggtctttggcccgggggatttatctcgctgtcacaccccggaagaaatcattgag
cttgttgatgtggtagaagcctttctggtgcttgactccttgcttgacatttggtcataa

DBGET integrated database retrieval system