KEGG   Thermodesulfatator indicus: Thein_1426Help
Entry
Thein_1426        CDS       T01546                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
tid  Thermodesulfatator indicus
Pathway
tid03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tid00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Thein_1426
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tid03400]
    Thein_1426
Enzymes [BR:tid01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Thein_1426
DNA repair and recombination proteins [BR:tid03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Thein_1426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEH45292
UniProt: F8AA06
LinkDB All DBs
Position
1499112..1500020
Genome map
AA seq 302 aa AA seqDB search
MLPAYIKPMLAKLSSPFDSPRFLYEIKWDGTRCLIFIENGKVRLQNRRLNDITYRYPEFW
DLPKLVPGDGIIFDGEIVVLKDGRPEFRLLQEREHVKSPLKIKMLSERLPATYMAFDLLY
FEGKPILDKPLRERKALLKELLPESPFVAESQYILEKGVAFFEQVVAQGFEGVMAKDLES
PYLPGKRVDFWLKFKPRGKRTCVIVGYLLRPDGTLKSLLIAEPTEKGLVYRGKVASGLNT
HLSAELLIRLKGLEDKKPENLKGRGFPKGARWVKPEIYCEVSFQEITNHGQFRAPVLEKV
FL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgttaccggcttatattaagcccatgctggccaagctctcaagcccctttgattcccca
cgctttctttacgaaatcaagtgggacggcacaaggtgccttattttcatagaaaacgga
aaggtgcgtttgcaaaaccgccgccttaacgacattacctatcgctacccggagttctgg
gacctaccaaagctcgttcccggtgacgggattatttttgacggcgaaatcgtggtctta
aaagacggccggcctgaatttcgcctgttacaggaaagagaacacgtaaagagtccgctg
aaaatcaaaatgctctccgagcgtctgcccgccacctacatggcctttgacctgctttac
tttgaaggaaagcctattttggataagcctttgcgtgagcgcaaggccctcttgaaagaa
ctgcttcccgaaagtccttttgtggcggagtctcagtatattctggaaaagggtgtggcc
ttttttgaacaagtggtagcccagggttttgaaggggttatggccaaggacttagaaagc
ccgtatcttccgggcaaaagggttgacttctggctcaagttcaagccccgcggaaaaaga
acctgcgtcatcgtgggctatttgttgcggccagacggcacgctaaaaagccttttgata
gctgagcccacagaaaaagggcttgtctatcgcggaaaagtggccagcggcttaaacact
catctttcggcggagcttttaatacggcttaaagggcttgaagataaaaagccggaaaat
ttaaagggaagagggttccccaaaggggcccgctgggtaaagccggagatttactgtgaa
gtttcttttcaggagataaccaaccacggccagtttcgggccccggtgcttgaaaaagta
tttctataa

DBGET integrated database retrieval system