KEGG   Thermodesulfatator indicus: Thein_2110Help
Entry
Thein_2110        CDS       T01546                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00030  Pentose phosphate pathway
tid01100  Metabolic pathways
tid01120  Microbial metabolism in diverse environments
tid01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Thein_2110
Enzymes [BR:tid01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Thein_2110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AEH45958
UniProt: F8ADE3
LinkDB All DBs
Position
complement(2187602..2189410)
Genome map
AA seq 602 aa AA seqDB search
MAGPYTNCILWVNLSNGEIRKENLSEEILRKFIGGRGVGSYYLSKLMDPKAEPFSAENPL
IFATGPLTGTPAPTGGRYMVICKSPLTGLIACSNSGGTFGAELKAAGYDMIIFEGVAEKP
VYLSIKDDEVELKSAEHLWGLDTHETTDRLQEEFGDTKAKVSCIGPAGENLVRFACIMND
KHRAAGRSGVGAVMGYKKLKAIVVRGTKRVEPAEAEIFKNFLREKLDIIRTNPVTGEALP
KLGTKVLDNIINESGLYPTRNFQTGVFEGTDEVCGEALVEKGYLKKNKGCYACPIKCGRV
TELPNKNKGEGPEYETGWAFGADCGVKDLIAITEANFLCNTLGLDPISCGATIACAMELF
EKGHIPKEDLAAGPKPVFGSSEAIVYYTHALAYRKGLGDKLAEGSKRLAEHYGAPELSMS
VKGQELPAYDPRGVQGHGLAYATSNRGGCHVRAYLIAPEVLGSPEKLDPQATEGKAQWVK
IFQDLTAVIDSMGLCLFTSFALGAEDYRDLLAAATGFDYTLEEMMQCGERIWNLERVFNL
KAGLDPKEDTLPKRLLEEPMPEGPNKGKVHRLPEMLPEYYEIRGWTKEGIPTEEKLKELG
LA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggctggaccttataccaattgtattttatgggttaacttatctaacggagaaataaga
aaagaaaacctttctgaagaaattttacgcaaatttattggaggaaggggtgtaggtagc
tattatctctctaagctgatggatcccaaggctgagcccttttctgctgaaaacccgctc
atctttgctactggtccacttaccggcacacccgctcctacgggtggccgttacatggtg
atttgtaagtctccccttacggggcttatcgcttgttccaactccggtggaacttttggc
gctgagcttaaagccgctggctacgacatgattatctttgaaggagtggctgaaaagcct
gtttatctcagcataaaagacgatgaggtagaacttaaatccgctgagcacctttggggg
cttgatacccatgaaaccaccgatcgcctgcaagaagaatttggtgataccaaagccaag
gtttcttgcattggcccggctggagaaaatctggtccgttttgcctgtattatgaacgac
aaacatcgggctgctggccggtcaggagtaggggcggtcatgggttataagaagctcaaa
gctattgtagtgcgtggcaccaaaagggtggaacccgccgaagccgaaattttcaaaaat
tttctccgggaaaaacttgacataattagaaccaaccctgtcaccggtgaagcgttgccc
aagcttggcaccaaagtgcttgataatatcatcaacgaaagtggtctttatccaacacga
aatttccagaccggtgtctttgaaggaaccgacgaagtttgtggtgaagccctggtggaa
aagggctaccttaaaaagaacaagggttgctatgcctgcccgattaaatgtggccgggta
acggaacttcccaacaaaaataaaggtgaaggccctgagtacgaaacaggctgggccttt
ggcgcggattgcggtgtaaaggacttaatcgctattactgaggccaatttcttgtgtaat
accctgggcttagatcccatatcctgtggggctactattgcctgtgccatggaacttttc
gaaaaaggccatattcctaaagaagatctggcagccggccccaaaccggtatttggtagc
tctgaagctattgtttactacacccacgcattagcttaccgcaaaggcttaggagacaag
ctagccgaaggttctaagcgtctggctgaacattatggagctccagagctttccatgtcc
gttaaagggcaggagctacccgcttatgatccccgcggggtgcagggccatggtctggct
tacgctacctcaaaccgtggaggttgccacgtaagagcatacctcattgctccagaagtg
cttggtagcccggaaaagcttgatcctcaggcaactgagggtaaggcccagtgggtaaaa
atctttcaggatttaaccgcggtgattgattccatggggctttgtctctttacttctttt
gccttgggagctgaagattaccgagaccttctggccgcggctacaggttttgactacacc
ttagaagaaatgatgcagtgtggtgagcgcatctggaatctggaacgcgtcttcaattta
aaagcaggccttgatcccaaagaagatactttaccaaaacgccttttagaagaacctatg
cccgaagggccaaacaagggcaaggtgcatcgtcttccagaaatgcttcctgagtattac
gaaatccgtggctggacgaaagaaggtattcccaccgaagagaaattaaaagaactgggc
ttggcttaa

DBGET integrated database retrieval system