KEGG   Thioploca ingrica: THII_0430Help
Entry
THII_0430         CDS       T03616                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
tig  Thioploca ingrica
Pathway
tig00020  Citrate cycle (TCA cycle)
tig00190  Oxidative phosphorylation
tig00650  Butanoate metabolism
tig01100  Metabolic pathways
tig01110  Biosynthesis of secondary metabolites
tig01120  Microbial metabolism in diverse environments
tig01130  Biosynthesis of antibiotics
tig01200  Carbon metabolism
Module
tig_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tig_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tig_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THII_0430
   00650 Butanoate metabolism
    THII_0430
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    THII_0430
Enzymes [BR:tig01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     THII_0430
    1.3.5.4  fumarate reductase (quinol)
     THII_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-ProteinID: BAP54727
UniProt: A0A090AHG4
LinkDB All DBs
Position
complement(489686..490465)
Genome map
AA seq 259 aa AA seqDB search
MVQLTLPPHSVVKKGQVVNPGTGANNVKKFIIYRWDPETPDNPRTDVYEIDLDHCGPMVL
DALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACTKPIEEIKGAVKIYPLPHME
VIKDLVPDLTHFYAQHAAIRPWLERQTPIPPDQEILQSKADRAKLDGLYECILCACCSTS
CPSYWWNGDRYLGPAILLQAYRWLVDSRDEMAGERLDNLEDPFRLYRCHTIMNCTNTCPK
GLNPAKAIVEIKKLLIQRR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttcaattgacgttaccacctcattccgttgtcaaaaaaggccaagtggttaatccg
ggtaccggcgctaacaacgtaaaaaaattcataatctatcgttgggatccagaaacacca
gacaatcctcgaaccgatgtttatgaaattgatttagaccattgcgggccgatggtatta
gacgcgctcattaaaattaaaaatgagattgattccaccttaacctttcgccgctcttgt
cgcgagggcatttgtggttcttgcgctatgaatattgatggcacgaataccttagcctgt
accaaaccgattgaagaaattaaaggggcggtaaaaatttatcctttaccgcatatggaa
gtgattaaagatctggtaccggatttaactcacttttatgcgcaacatgccgccatcaga
ccttggttagaaagacaaacgcccattccgcccgatcaagaaattctacaatcaaaagcc
gatcgtgccaaattagatggattatatgaatgtattttatgtgcttgttgctcaaccagt
tgtccaagctattggtggaacggcgatcgttacctaggacccgctattttattacaagcc
taccgttggttggttgatagccgcgatgaaatggctggcgaacgtttagataatttagaa
gatccatttcgcttataccgctgtcatacgattatgaattgtacgaatacttgtccgaaa
gggttaaatccggcgaaagccattgtcgaaattaaaaagctgttaatccagcggcgttaa

DBGET integrated database retrieval system