KEGG   Thioploca ingrica: THII_0431Help
Entry
THII_0431         CDS       T03616                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
tig  Thioploca ingrica
Pathway
tig00020  Citrate cycle (TCA cycle)
tig00190  Oxidative phosphorylation
tig00650  Butanoate metabolism
tig01100  Metabolic pathways
tig01110  Biosynthesis of secondary metabolites
tig01120  Microbial metabolism in diverse environments
tig01130  Biosynthesis of antibiotics
tig01200  Carbon metabolism
Module
tig_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tig_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tig_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THII_0431
   00650 Butanoate metabolism
    THII_0431
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    THII_0431
Enzymes [BR:tig01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     THII_0431
    1.3.5.4  fumarate reductase (quinol)
     THII_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 FAD_oxidored DAO
Motif
Other DBs
NCBI-ProteinID: BAP54728
UniProt: A0A090AB03
LinkDB All DBs
Position
complement(490478..492268)
Genome map
AA seq 596 aa AA seqDB search
MSTAYQIIDHRYDVVVVGAGGAGLRATLGMAEKGLTTACITKVFPTRSHTVAAQGGISAS
LGNMGPDNWRWHMYDTVKGSDWLGDQDAIEYMCREAVPAIIELEHYGVPFSRTEEGKIYQ
RPFGGMTTNYGQGIAQRTCAAADRTGHAILHTLYQQSLKYQAEFFIEYFALDLIMDDNGV
CRGVMALNLAEGTIHRFAAHMVVLATGGCGRVYFSSTSAHSCTGDGGGMALRAGLPMQDM
EFIQFHPTGIYGSGCLITEGARGEGGFLTNSDGERFMERYASTAKDLASRDVVSRAITVE
IREGRGVGEHKDHIHLHLEHLGAEVINERLPGISESTRIFAGIDITKEPIPVLPTAHYIM
GGIPTNHYGEVVTLKEGNPDKVVRGLIAIGETACVSVHGANRLGSNSLLDIIVFGRAAAI
RCSQILTRNAPHKPLPRQAGEETLARLDKLRYANGHLTTAAIRLDMQNTMQNHAAVFRSG
ATLQAGVEKIQAIFNAFADVKITDRSLIWNSDLMETLELDNLLRQAMVIMNSAGNRTESR
GGHAREDYPQRDDNNWLKHTLAWLDLQGQVTLDYRPVHLYTLTDEVEVIPPKARIY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
ttgtctaccgcataccaaattattgatcaccgttatgatgtcgtggtcgtcggtgcaggg
ggggcagggttacgtgctaccttgggcatggccgaaaaaggtttaacgactgcctgtatt
actaaagtgtttcctactcgaagtcacaccgtggctgcacaaggcggaatcagtgcctcc
ttaggcaatatgggtccggataattggcgctggcatatgtatgatacggtaaaaggttca
gattggttaggtgatcaagacgcgattgaatacatgtgccgggaagccgtacccgcgatt
attgaactagaacattatggggtgcctttttcgcggactgaagaaggtaaaatttatcaa
cgcccttttggtggaatgaccactaattatggccaaggcattgcccaacgaacctgtgcc
gctgctgatcgaaccggacatgcgattttacataccctctaccaacaatcgctcaaatac
caagctgaatttttcattgaatactttgccttagatttaatcatggacgacaatggtgtt
tgtcgcggcgttatggcgctgaatttggcagaaggaactatccaccgttttgctgctcat
atggtggtgcttgctactggaggttgtggacgagtctatttttcctcaacctcggcgcat
agttgtactggtgatggtggtggcatggcattgcgagctgggttaccgatgcaagatatg
gaatttatccaatttcatccaactggtatctatggttccggctgcttaattaccgaaggt
gctcgtggcgaaggcggtttcctgaccaattcggatggggaacggtttatggagcgttat
gcttccaccgccaaagatttggcttcgcgtgatgtggtaagccgagcgataactgtcgag
attcgagaaggacgtggtgttggtgaacataaagaccatattcatttacatcttgaacat
ctcggtgctgaggttatcaatgaacgattaccggggattagtgaatcaacccgaattttt
gctggcatcgatatcactaaagaaccaattccggtattacccaccgcgcattacattatg
ggtggtattccaacgaatcattacggagaagtggtcactctaaaagaaggtaatcccgat
aaagtggtacggggactcatagcgattggagaaaccgcttgtgtatcggtacatggtgcc
aatcggttaggttccaattcgttattagatattattgtctttggtagagccgccgctatt
cgttgttcacaaattttaactcggaacgcccctcataaacccttaccacgccaagcgggt
gaagaaactttagctcgtctggataaattgcgttacgctaacggtcacttaacgacggca
gcaatccgtttagacatgcaaaacaccatgcaaaaccatgcggccgtgtttcggagtggt
gcaaccttacaagctggggtggaaaaaattcaggctattttcaacgcgtttgcagatgtc
aaaattactgatcgttctttaatttggaattctgatctaatggaaacattagaactcgat
aatctgcttagacaggcgatggttatcatgaactccgccggtaatcgcaccgaaagtcgt
ggcggtcatgcacgggaggattatccccagcgtgatgacaacaattggcttaaacatact
ttagcttggttagatcttcaaggtcaggttaccctcgattatcgaccagtacatttatat
actttaaccgatgaagttgaagtcattccgcctaaggcacgtatttattaa

DBGET integrated database retrieval system