KEGG   Thioploca ingrica: THII_1783Help
Entry
THII_1783         CDS       T03616                                 

Definition
(GenBank) major facilitator superfamily transporter
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
tig  Thioploca ingrica
Pathway
tig00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:tig00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    THII_1783
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tig02000]
    THII_1783
Transporters [BR:tig02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    THII_1783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: BAP56080
UniProt: A0A090ALQ5
LinkDB All DBs
Position
complement(2135921..2137288)
Genome map
AA seq 455 aa AA seqDB search
MDIKNKATRINLLDFSSPPMRAFHVTWFAFFSCFFGWFGIAPLMAIVRDDLQLTKTQIGN
TIIASVAITIIVRLLIGPLSHRYGPRKTYTGLLILGSIPVMCIGLADSYESFLLFRLAIG
AIGASFVITQYHTSLMFAPNCVGTANATTAGWGNVGGGVTQMVMPMVLAVVMMFVAEQSL
GWRIAMVIPGIILFTVGIAYWLLTQDTPNGNFDELRARGELEAAAGENSALASFIAAVED
YRVWILFLTYATCFGVELTIDNIAALYFHDKFELDVTTAGLIASLFGLINIFARTLGGVC
SDLFAKHHGFMGRVQFFFAVLLLEGIALLIFSQMNSLSLAIITLLIFSLFVQMSTGASFG
IVPFVNKKALGAVAGIVGAGGNVGAVMAGFLFRSEALTTQEALFYLGIAVILSSFFILAI
RFSPEKVQEENDALHRALAEREAAVGTLKPAMVEV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtggatatcaaaaacaaagccacgcgcattaatttacttgatttttctagtccacccatg
cgggcatttcatgtgacttggtttgctttcttctcttgcttctttgggtggtttggtatc
gcaccgctgatggctatcgtacgtgatgacttacaactgaccaaaactcaaattggtaat
accattatcgcctcggttgctatcaccatcattgtccggttattaattgggccactatca
catcggtatgggccacggaaaacttatactggcttattaattttaggctctattccggtg
atgtgtatcggtttagcggatagttatgaaagctttttgttatttcgtttggcgattgga
gcgattggcgcttctttcgtgattacgcaatatcacacttccttaatgtttgcgcctaat
tgtgttggtaccgctaatgcgactactgccggttggggcaacgttggtggtggtgttacc
cagatggttatgccgatggtgttggcggtagtgatgatgtttgtcgccgaacaatctctc
ggctggcggattgcgatggtgattccgggtattatattattcacggtgggtatcgcttat
tggttattaactcaagacacccccaatggtaattttgatgaattacgtgcgcgcggcgag
ttagaagcagccgctggagaaaatagtgccttagcttctttcatagccgcagttgaagat
tatcgggtgtggattctatttctcacctatgcaacttgttttggcgtggaactcactatc
gataacattgcggcactgtattttcacgataaatttgaattagatgttactactgcaggt
ttaattgccagcttattcggtttaataaatatctttgcccgtactttaggcggcgtttgc
tccgatctattcgctaaacatcatggctttatggggagagtccaatttttctttgccgtc
ctattattagaaggcatcgcgttattgatattctcccaaatgaacagtttaagcttagcc
attatcaccttactcatctttagcttatttgtgcaaatgtccaccggagccagttttgga
attgtaccttttgtcaataaaaaggctttaggtgcggtggcgggaattgtcggtgctggg
ggtaatgttggtgccgtgatggccggtttcctgttccgttcggaagcattgactacccaa
gaggcactgttttatctcggcattgcggtgatcttgtcatccttcttcattttggcaatc
cgtttctctccggagaaagttcaagaagagaatgacgctttgcaccgggccttagccgaa
cgagaggctgccgtggggacgctaaaaccagctatggttgaggtttaa

DBGET integrated database retrieval system