KEGG   Thioploca ingrica: THII_1873Help
Entry
THII_1873         CDS       T03616                                 

Definition
(GenBank) transketolase, N-terminal subunit
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
tig  Thioploca ingrica
Pathway
tig00030  Pentose phosphate pathway
tig01100  Metabolic pathways
tig01110  Biosynthesis of secondary metabolites
tig01120  Microbial metabolism in diverse environments
tig01130  Biosynthesis of antibiotics
tig01200  Carbon metabolism
tig01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    THII_1873
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    THII_1873
Enzymes [BR:tig01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     THII_1873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: BAP56170
UniProt: A0A090ALX1
LinkDB All DBs
Position
2244230..2245138
Genome map
AA seq 302 aa AA seqDB search
MWQAEVRRVALGIRQRVFEHTIKNQGGYLSQACSAADFLATLYVKTLNLGPSIAPPVPRP
FAGPPGVNNPNSFTGADYHGAKQPEYDRFFISPAHYALVIYAALIETGRMAPAGLDLFNQ
DGSSVEMIGAEHSPGMEVTTGSLAQGLSMAAGVALARKLKQEPGRIWVFLSDGELQEGQT
WEAFQVIHHYALDNLAVIVDVNGQQCDGAMDSVLLPGAFAAKLTAFGAQVVEVDGHDIEA
LQRAAAIKPSQRALVILAKTCPYQGMDYLKKRYPRLHYVRFRSAKEFDEFEAAIRQQLYH
LK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaagctgaggtaagacgtgtcgctttaggtattcgccaacgcgtttttgaacat
actatcaaaaatcagggtggttatctcagtcaagcttgttccgcagcggactttttagcc
accctgtatgtcaaaacacttaatcttggacccagtattgcgccacccgttccccgccct
tttgctggtccacccggcgtaaataatcccaacagctttactggcgctgattatcacggt
gctaagcaaccagaatacgaccgcttttttatcagtccggcgcattacgccttggttatc
tatgccgcactcatcgaaactggcagaatggcaccggccggattagatcttttcaatcaa
gatggtagtagcgtggaaatgatcggtgccgaacattcgcccgggatggaagtcactacc
ggttcgctggcgcagggattgagtatggcggcaggggtggcattagccagaaaactgaaa
caagagcctggaagaatatgggttttcctctcagatggcgaattacaagaagggcaaact
tgggaagctttccaagtgattcaccattacgccttggataatttagccgtgattgtcgat
gtcaatggtcaacaatgcgatggcgcgatggattctgtcttactaccgggtgcctttgct
gctaaactgactgcttttggcgcacaggtcgtggaagtcgatggtcacgacatcgaagcc
ttgcaacgggcagcggccatcaaaccatcacagcgtgcgcttgtaatcctggctaaaact
tgtccttatcaaggcatggattacctgaaaaaacgttatccacgtttgcactacgtgcgg
tttcgctccgccaaagaattcgatgaatttgaagcagcgattcggcaacaactttatcac
ctcaagtaa

DBGET integrated database retrieval system