KEGG   Thioploca ingrica: THII_3036Help
Entry
THII_3036         CDS       T03616                                 

Definition
(GenBank) protein kinase family protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tig  Thioploca ingrica
Brite
KEGG Orthology (KO) [BR:tig00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tig01001]
    THII_3036
Enzymes [BR:tig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     THII_3036
Protein kinases [BR:tig01001]
 Serine/threonine kinases: Other
  Bacterial family
   THII_3036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase CHASE2 Pkinase_Tyr TPR_16 APH POTRA_3 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: BAP57333
UniProt: A0A090AGH6
LinkDB All DBs
Position
3628779..3631409
Genome map
AA seq 876 aa AA seqDB search
MNNIQEKIWSHDWFISLIIGIILFIMAQLNLLQPIEQALYDAHIRWFNRAAGDKVAVIAI
DERSLAQLGDWPWSRTTLAQLIDLLSPQAQVIGTTLPFNHFQTERGLVYFDELVKFYTHS
KLLNPLPKQLEQLNTFFKKLSELRTRQSNKQFIKDIDEFYRNSLFPHELADTLTTFEDKL
QAIRIDLESDQQLATSFKAAGQVVLGMPFTLAQTNYEEPGPDLPNYITQYRLKNIRDQFE
QYNLTPQPPTAINASSPLAIFSENTTGIGYFNAEQLTNPRQIPLVIKYNQAYFPSLPLLL
AAKSLHLDNNQIEISLGKGIRLEKLTVKTEPSLQIRPFFYRHTPPPDSFVDVLTGRVPIQ
KYQGKIVLLGITVRHYTPFHSTPIGEIPSILVLAHTLRSLLNQDFFTIPQWATGLQISLL
LLVTANVGLLLPHLRRRQALIMGLGLMGVLYLLYFSLLNQGLLVQLMHGILLVPCGYLAL
QIKQGIIAYQDAFRSHPDAVESNRLLGLAFQGQGQLDMAFEKFRLCPPDNAIMGLLYNLA
LDYERKRQWRRASAVYRYMLNHIPHFRDIEQRLERLNRLRKPRLSRGAINDWLSPEDNND
KPILGRYQIEKLLGKGAMGTVYLGKDSKLNRLVAIKTLPLSQEFEAEGLQEATIRFFREA
AAAGRLKHPNIVSIYDAGEEQDLAFISMEFFKGGNLVPYTQSDNLLAIPAVVKIGVYIAE
ALDYAHSQGVVHRDIKPANIMYNPATDQIKMTDFGIARITDSNKTKTGIILGTPSYMSPE
QLAGKSLDGRTDLFSLGVMLYQLLTGILPFQADSMATLMFKIANEPHPDIISIRPDIPPC
LKQVVDIALQKNAQDRYQNGAQLAQALRDCGNLNED
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatacaagaaaaaatttggagtcatgattggtttattagcttgattatcggt
attattttattcatcatggctcaacttaatttattacaaccaatcgaacaagccctctat
gacgctcacatccgctggttcaaccgagcagcaggggataaagtggctgttattgctatt
gatgagcgtagcttggcacaattaggtgattggccttggtcacgaaccactttggcacaa
ttaatcgacttattatcaccacaagcacaggttatcggtacaaccctcccatttaatcat
ttccaaaccgagcgaggtctagtttatttcgatgaattagttaagttttatactcattcc
aagttacttaaccccttaccaaaacaattagaacagttaaatactttttttaaaaaatta
agtgaattacgtactcgtcaaagtaataaacaatttattaaagatatcgatgaattttat
agaaattctctatttcctcatgaattagcggatactttaactacatttgaagataagtta
caagcgattcgcattgatttagaaagtgatcaacaactggccaccagttttaaagccgcc
ggccaagttgtcttggggatgccttttactttagctcaaactaattatgaggaaccaggg
cctgatttaccgaattatatcacccaataccgtcttaaaaatattcgcgatcaatttgag
caatataatttaaccccgcaaccacccacggcaattaatgcgagttcaccgttagccatt
tttagtgaaaatacgaccggaataggttatttcaatgccgagcaactcactaatccacgt
caaataccgctagtcattaaatataaccaagcttattttccctcactccctttgttactg
gctgctaaaagtctacacttagataataaccaaattgaaattagcttaggtaaagggata
cgtttagaaaaattaaccgttaaaactgaaccgtctttacagataaggccttttttctat
cgtcatacacctccgccggactcatttgttgatgtgttaactggacgggttccaatccaa
aaatatcaaggcaagatcgtgttacttggcataacagtacgtcattatactccatttcac
tccaccccgatcggtgaaataccctccattttggttttagcgcatactttaagaagtcta
cttaaccaagatttttttacaattcctcaatgggcgactgggttacaaattagcctattg
cttctagttactgccaatgttggtttattattgcctcatttaaggcgacggcaagctttg
attatgggtcttggattgatgggagtactttatctactctattttagtctgttaaatcaa
gggttattggtacaattaatgcatggaattttgctagtaccctgtggatatcttgcttta
caaattaaacagggaattatagcttatcaagatgcttttcgctcacatcctgatgccgtt
gaaagtaatcgtttactcgggctagctttccagggacaaggacagttagatatggcattt
gaaaagttccggttatgtccacctgataatgcaattatggggctactttataatctagca
ctggattatgaacggaaacgtcaatggagacgcgctagtgcagtctaccgttatatgctt
aaccatattcctcactttcgtgatatagaacaacgtttagaacgattaaatcgcttaaga
aaacctcggttatcaaggggagctatcaatgattggttgtcaccggaagacaataatgac
aaaccgattttaggacgttatcaaatagaaaagcttttaggtaaaggtgctatgggtaca
gtctatctcggtaaagattcaaaattgaatcggttagtagccattaaaactctaccctta
tcacaagaatttgaggcggagggattacaagaagcgactatccgattttttcgcgaagcg
gcagccgccggacgattaaaacatcctaatattgtttctatttacgatgcaggagaagaa
caagacctcgcattcatttcaatggaattttttaaagggggtaatttagttccttataca
caatcagataatttgttagccattcccgcagttgttaaaataggagtctatatagcagaa
gctttagattatgcgcatagtcaaggtgtagtccatcgagacattaaaccagctaacatc
atgtataatccagcgactgatcaaattaaaatgactgattttggaattgctcgcatcact
gactcaaataaaaccaagactggtattattttaggaacaccttcatatatgtcaccagag
caattggctggtaaatcacttgacggacggactgatttattttctttaggtgtcatgtta
tatcagctattaaccggcatattaccgtttcaagctgattcaatggcgactttaatgttt
aaaattgccaatgaacctcatccggatattattagcattcgtcccgatatcccaccttgt
ttaaaacaagtcgtcgatatcgctttacaaaaaaatgctcaagatcgttaccaaaatggt
gcacaattggctcaagcattgcgtgattgcggcaatcttaatgaggattag

DBGET integrated database retrieval system