KEGG   Thioploca ingrica: THII_3311Help
Entry
THII_3311         CDS       T03616                                 

Definition
(GenBank) ribulose bisphosphate carboxylase form I, large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tig  Thioploca ingrica
Pathway
tig00630  Glyoxylate and dicarboxylate metabolism
tig01100  Metabolic pathways
tig01120  Microbial metabolism in diverse environments
tig01200  Carbon metabolism
Module
tig_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:tig00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    THII_3311
Enzymes [BR:tig01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     THII_3311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAP57608
UniProt: A0A090AH38
LinkDB All DBs
Position
3989449..3990870
Genome map
AA seq 473 aa AA seqDB search
MAKKTYQAGVKEYRETYWDPNYTPKDTDLLACFKVTPQEGVPREEAAAAVCAESSTGTWT
TVWTDLLTDMDHYKGRAYRIEDVPGDDTCFYAFVAYPIDLFEEGSVVNVFTSLVGNVFGF
KAIRALRLEDVRFPIAYVMTCGGPPNGIQVERDRMNKYGRSLLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWRNRFEFVMEAIHKAQAETGERKGHYLNVTAPTP
EDMYERAEFAKELGAPIIMHDYLTGGFCANTGLANWCRKNGMLLHIHRAMHAVLDRNPHH
GIHFRVLTKALRLSGGDHLHSGTVVGKLEGDRHATLGWIDMMRDKYIKEDRSRGIIFDQD
WGSMPGVFPVASGGIHVWHMPALVSIFGDDAVLQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNQGAQLEKEGKEILTNAAKHSPELKMAMETWKEIKFEFDTVDKLDVAHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaaaaaacttatcaagccggtgtcaaagaataccgtgaaacttattgggatcct
aattatacgccaaaagatactgatcttttggcttgctttaaagttactcctcaagaagga
gtaccccgtgaagaagctgcagcagccgtttgtgcagaatcttctactggaacttggaca
acggtatggaccgatttacttaccgatatggatcattataaaggacgggcgtatcgtatc
gaagatgtaccaggagatgatacctgtttttatgccttcgttgcttatcccattgaccta
tttgaagaaggttcagtggttaacgtatttacctctttagtcggtaatgtatttggtttc
aaagcgatacgggcattacgtctagaagatgttcgtttccctatcgcttacgtcatgacc
tgtggtggtccacccaatggtattcaagttgaacgcgaccggatgaataaatatggtcgt
tcacttctcggctgtaccattaaacctaaattgggtctgtctgccaagaattacggtcgt
gctgtttatgaatgcctacgtggcggtttagacttcactaaagacgatgagaatgttaat
tctcaaccgttcatgcgttggcgtaatcgttttgaattcgtcatggaagctatccacaaa
gcgcaggctgaaaccggtgagcgtaagggtcactatctgaacgtcaccgcacccactcca
gaggacatgtacgaacgggctgaattcgctaaggaattaggtgcaccgattatcatgcac
gactacctgactggtggtttttgtgccaatactggtctagccaattggtgtcgtaaaaac
gggatgttattacacattcaccgggcgatgcatgctgtccttgaccgcaatccccatcat
ggaattcatttccgggtattaactaaagcattacgtctctccggtggtgatcatttacat
tcgggtactgtcgtaggtaagttagaaggtgatcgtcatgccactttaggttggattgat
atgatgcgtgacaaatatatcaaggaagatcgctccagaggcattatctttgatcaagat
tggggttcaatgccgggtgtattcccagtcgcttccggtggtatccatgtgtggcatatg
cccgctttagtcagcatctttggtgatgatgcggtcttacaatttggtggtggtaccttg
ggtcatccttggggtaatgccgctggtgcagcagctaaccgggttgccttagaagcctgc
gttgaagcccgtaaccaaggtgcccaactcgaaaaagaaggtaaagaaatcttaaccaac
gcggctaaacatagtccggaactcaagatggccatggaaacttggaaagaaatcaaattt
gaatttgataccgttgacaagttagacgttgcccataaatga

DBGET integrated database retrieval system