KEGG   Thalassospira indica: DY252_00040Help
Entry
DY252_00040       CDS       T05581                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
tii  Thalassospira indica
Brite
KEGG Orthology (KO) [BR:tii00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DY252_00040
Enzymes [BR:tii01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     DY252_00040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 ThiF AdoHcyase_NAD Pyr_redox_2 Shikimate_DH DUF43 2-Hacid_dh_C D-ser_dehydrat MTS Pyr_redox_3 PrmA Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AXO12825
LinkDB All DBs
Position
complement(9249..10292)
Genome map
AA seq 347 aa AA seqDB search
MQTRVCRLYGQDDLRIETEATTDPVGDEVLIRVGAGGVCGSDMHYYFEGGIGQIRVREPI
ILGHEAAGTIVALGPDVNGLSVGQKVAINPSHPCGTCKYCQQNLQQHCLNMKFFGSAMPM
PHIQGAFRDLVNVGQGQCHVIGDQTDIGKAACAEPLAVCLHAVARAGDLSGKKVLITGAG
PIGSLCAAAAKRAGASEIVVTDLQDFALDVARQMGATRTINIANAADDLAPYEAEKGQFD
VCLECSAAPAALRTAIATLRPQGILVQVGVAGEMPVPFNPLVAKELTITGTFRFHTEFAE
AVGMIDRGEIDVAPIITQTFTLETAKDAFDVARDRSKSVKVQLSFAD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacgcgtttgccggctttatggccaagatgatctgcggatcgaaaccgaagca
accaccgatccggttggcgatgaagtcctgatccgggtcggggcaggcggcgtctgcggt
tcggacatgcattactatttcgaaggcgggatcggtcagatccgtgtccgcgaaccgatc
attctgggtcacgaggccgccggtacaattgtcgcactcggtccggatgtcaacggcttg
tccgtcgggcagaaagtcgcaatcaatccaagtcatccctgtggcacctgcaaatattgc
cagcagaacctgcaacagcattgcttgaacatgaagttctttggctcggccatgccgatg
ccccatattcagggcgccttccgcgatctggtcaatgtcgggcaggggcaatgccatgtg
attggcgatcaaacagatatcggcaaggcggcctgcgccgaaccgctggctgtctgtctt
catgcggttgcgcgtgcgggcgatctgtcgggcaaaaaggtgctgattaccggtgccggt
ccgatcggaagcctgtgtgccgctgcggccaaacgcgccggggccagcgaaatcgtcgtg
accgacctacaggattttgccctcgatgttgcccgccagatgggggcaacgcgcacgatt
aatatcgccaacgccgccgatgaccttgcgccttacgaggccgaaaagggccagtttgac
gtctgtctggaatgttcggccgcaccggcggcgctgcgcaccgcaattgcgacgctgcgt
ccgcagggcattcttgtgcaggtcggagtggccggtgaaatgccggtgccattcaacccg
ctggtcgccaaggaactcaccattaccggcaccttccggttccacaccgaatttgccgag
gcggttggcatgattgatcgcggcgagattgatgtcgcaccgatcatcacccagaccttt
acgcttgaaaccgcaaaggacgcctttgatgtcgcccgcgaccgcagcaaatcggtcaag
gttcagctttccttcgccgactga

DBGET integrated database retrieval system