KEGG   Thalassospira indica: DY252_00865Help
Entry
DY252_00865       CDS       T05581                                 

Definition
(GenBank) histidine phosphatase family protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
tii  Thalassospira indica
Pathway
tii00860  Porphyrin and chlorophyll metabolism
tii01100  Metabolic pathways
Module
tii_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:tii00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DY252_00865
Enzymes [BR:tii01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     DY252_00865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 NAD_binding_1
Motif
Other DBs
NCBI-ProteinID: AXO16648
LinkDB All DBs
Position
complement(185145..185723)
Genome map
AA seq 192 aa AA seqDB search
MRHAPVQNPKRLVYGQSDMPADLSDQKALAALAGQLPRDAVWVTSHLSRTHDTARGLQAF
MDKDVAPQAESGFAEQHFGDWELQNWNDLPKGETTRFWTDFARQHPPKGESFADVVARVG
PVFDQLNSDWAGKDIVAIVHGGTVRALLANALGLSLETALAFHVDTLGLTTLEYIDGVEE
PGWRVNGVNQRF
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcacgcgcccgtccaaaatccgaaacggctcgtctatggccaaagtgacatgccc
gccgacctttccgatcaaaaggcccttgcggcccttgcggggcaacttccacgtgatgcc
gtctgggtgaccagccatctgtcccgcacgcatgatacagcgcgcggtcttcaggccttc
atggataaagacgtagcgccgcaggctgaaagcggctttgccgaacagcatttcggtgat
tgggaattgcagaactggaacgatttgcccaagggggaaacaacacgtttctggaccgac
tttgcccgccaacaccccccaaagggtgaaagctttgccgatgtggttgcccgtgtcggg
ccggtctttgatcaattaaacagcgattgggccggtaaggacattgtggcgatcgtgcat
ggcggtaccgtgcgcgcccttctggcgaatgcgttgggcttatcccttgaaacagcactg
gcatttcatgttgatacgctgggtttgaccacgcttgaatatattgacggggtcgaagag
ccgggctggcgcgtaaacggggttaatcagcgcttctaa

DBGET integrated database retrieval system