KEGG   Thalassospira indica: DY252_05410Help
Entry
DY252_05410       CDS       T05581                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
tii  Thalassospira indica
Pathway
tii02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tii00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DY252_05410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tii02000]
    DY252_05410
Transporters [BR:tii02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    DY252_05410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_6 SBP_bac_1 SBP_bac_11 GH97_N
Motif
Other DBs
NCBI-ProteinID: AXO13722
LinkDB All DBs
Position
1121653..1122735
Genome map
AA seq 360 aa AA seqDB search
MTVFSRRFSRFCAQVAVLVLAMLWGTQALARVQVHVWSATDTSAVEPFIKVFETKYPDID
VVYREFNTSELYQVVMYNIDNPKMEADVIISPAMDLQVKLVNEGLAYRFEPENVDAIPSW
AQWRNELYGFSFEPAALVYNKQAFEGLESPVSHTDLSNMVRDNPELFSGKIGTYDIRQSG
IGYFFATQDAIQNNQTSRLTETFGRAGAKLFCCSSEILDRVATGELVLGYNVIGSYAMAA
ARENPDIGVYFLRDYTITMSRTAFVPKTSKAKYQAQLFIDFLLSREGQQVLANNSALIPI
NQNVETVLTPHLEDIPVFRVKLGIGLLGFQDELKKKSFLEDWESSILWSGGTASPSYQVD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacggtattttcccgacgcttttcgcgcttttgcgcgcaggtcgcggttctggttttg
gcgatgctttggggcacgcaggcccttgcgcgtgttcaggtgcatgtctggtcggcgacc
gatacctcggcggtcgagccctttatcaaggtgtttgagacgaaatatcccgacattgac
gtcgtctatcgcgagttcaataccagcgaactttatcaggttgtcatgtacaatattgat
aacccgaaaatggaagccgatgtgatcatcagcccggcaatggatttgcaggtcaaactg
gtcaatgaggggctggcctatcggtttgagccggaaaacgtcgatgcgatacctagttgg
gcccagtggcgcaacgagctttacgggttttcctttgagccggcggcacttgtttataac
aaacaggcgtttgaaggattggagagcccggtttcacatacggatctgtccaatatggtg
cgtgacaatccggaattgttcagtggaaagattggcacctatgacattcgccaatcgggg
atcggatatttctttgccactcaggatgccattcagaacaaccagacatcacgtctgacc
gaaacattcggtcgcgcaggcgcaaagttgttttgttgttcgtcggaaattctcgaccgc
gttgcgactggggagctggtgctgggctataacgtgattgggtcctatgccatggccgcg
gcacgggaaaacccggatatcggggtatatttcctgcgcgattacactatcacaatgagc
cgcacggcctttgtacccaagacgtccaaggccaaatatcaggcgcaactgttcatcgac
tttttgctgtcgcgcgaagggcagcaggttctggcaaacaattcggcacttattccgatc
aatcagaatgtcgaaacggtgcttaccccgcatctggaagacatcccggtattccgggtg
aagttggggattggcttgctgggctttcaggacgagctcaagaagaagagcttccttgaa
gattgggagtcttcaatcttgtggagcggcgggacagcaagcccgtcatatcaggtcgat
tag

DBGET integrated database retrieval system