KEGG   Thalassospira indica: DY252_11280Help
Entry
DY252_11280       CDS       T05581                                 

Definition
(GenBank) HAMP domain-containing protein
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
tii  Thalassospira indica
Pathway
tii00230  Purine metabolism
tii01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tii00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DY252_11280
Enzymes [BR:tii01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     DY252_11280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc HAMP Limkain-b1 dCache_1
Motif
Other DBs
NCBI-ProteinID: AXO14726
LinkDB All DBs
Position
complement(2355939..2357816)
Genome map
AA seq 625 aa AA seqDB search
MGKTSFLEENRLKSKRRYSVLSVLLAGFIATSVFGVGLSLYVGLGTAYENTRNLWVMLAD
IDLTSVQRTMHERMDEVEQRSDWVAEQVAIGALDPSFQYGWTSTMRALAAADMGVMAYGL
VTGEREFIGFNPEDMSDIRRTLPEDDMLFSELAHIRGPISNRTGYPRWDPYFDRTVLTSW
VPLFYDGQYLGTFIQYLSLSNLSESLIRGREDLPGTPFVLIGGNRVMAHPGLRNWGEKTT
TELVNGDNIARSPIPLPTIHDIGDPVLANIGKSESIRLDPDDERHNSGIRLSGLEHNDRY
HLIVTRQVQTAPISPVVIGMYFDQELLDDEWDRLVLASVLGGAVFILSVIVAIVLSRHFT
KPIRRFASAARAFEDEDIASIDVPQLKGSRIREYDDAARSFNHMMMAVHDRERITSLFGK
FVPQSIAKKLLASGNDSGVLPPQTSEATVLFVDIVGFTSMCESLDPKQIIAMLNDYFDCA
TQIIERHGGIITQFQGDAILAVYNVFDDLKNHADAAVDSAIALQAEVEKRKFEGLELKVR
CGVNTGPMVAGNVGAKARLSFTVHGDAVNTASRLEQENKVLGTQILISETTRNLLADPDR
VAKAGDVLLRGRHTTTELFTTRPDK
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
ttggggaaaacctcttttctggaagaaaaccgattgaaatcaaaacgcagatattcagtc
ctttctgtactgcttgccggttttatcgccaccagtgtctttggcgtcggactatccctt
tatgtcggtcttggaacggcctatgaaaacacccgcaatctgtgggtgatgctggctgat
attgacctgacatcggtgcagcgcaccatgcatgaacgcatggacgaggtcgaacaacgt
tctgactgggtcgcagaacaggttgccattggcgcgcttgatccaagttttcagtatggc
tggaccagcacgatgcgcgcccttgcagccgcagacatgggcgtaatggcctatgggctt
gtgaccggggaacgtgaatttatcggctttaatcccgaagacatgagcgacattcgaaga
accctgcccgaagacgacatgctgttttccgagcttgcgcatatccgcgggcctatcagc
aaccgcacgggctatccgcgttgggacccctattttgaccgcactgttctaacaagctgg
gtaccgctgttttatgacgggcagtatctgggaacgttcattcagtatctttcgctgtcc
aatttgtcagaaagcctgatccgcgggcgcgaagatttgccaggcacgccctttgtcctg
attggcggcaatcgggtcatggcccatccgggattgcgcaactggggggaaaaaacaaca
accgagctggtcaatggcgataacatcgcacgcagcccgattcccctgcccaccattcat
gacattggcgaccctgttcttgccaacatcggaaaatccgaaagcatccggcttgatccc
gatgacgaacgccacaatagcggcattcgcctttcagggcttgagcacaatgatcgctat
cacctgatcgtcacgcgccaggttcaaaccgcgccaatttcaccggtcgtgattggcatg
tattttgaccaggaattgcttgacgatgagtgggacagactggttctggcctctgttctt
ggcggtgctgtctttatcctgtctgtgatcgttgccatcgtcctgtcgcgacacttcacc
aagccgatccgcaggtttgccagtgctgcccgcgcctttgaagacgaagacatcgcatcc
atcgatgtgccacaacttaaaggcagccgcattcgcgaatatgacgacgccgcgcgatca
ttcaatcacatgatgatggcggtacatgaccgcgaacgtatcaccagcctgtttggtaag
ttcgtgccgcaatccattgccaaaaagcttctggcatcgggcaatgattccggcgtcctg
ccgccgcaaacatccgaagccaccgtgctttttgtcgatatcgtcggtttcacttcgatg
tgcgaaagcctggatccgaaacagatcattgcgatgcttaatgactatttcgactgcgcg
acgcagatcatcgaacgccatggcggcatcatcacccagttccagggcgatgcgatcctt
gcggtctataacgtgtttgatgatctaaaaaaccacgccgatgccgctgtcgatagcgcc
attgccctgcaagccgaagtcgaaaagcgcaagttcgaagggcttgagttaaaagttcgc
tgtggtgtgaataccggcccgatggttgccggtaatgtcggcgcaaaagcccgtctgtca
ttcactgtccacggggatgccgtcaatacagcatcacgccttgaacaggaaaacaaggtt
ctgggaacacaaatcctgatctcggagacaacccgcaacctgctggctgatcctgatcgt
gttgccaaggcaggtgatgtgcttttgcgcggacgtcataccacgacagagctgtttaca
acccggcccgacaaataa

DBGET integrated database retrieval system