KEGG   Thalassospira indica: DY252_13185Help
Entry
DY252_13185       CDS       T05581                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tii  Thalassospira indica
Pathway
tii00010  Glycolysis / Gluconeogenesis
tii00020  Citrate cycle (TCA cycle)
tii00620  Pyruvate metabolism
tii01100  Metabolic pathways
tii01110  Biosynthesis of secondary metabolites
tii01120  Microbial metabolism in diverse environments
tii01130  Biosynthesis of antibiotics
tii01200  Carbon metabolism
Module
tii_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DY252_13185
   00020 Citrate cycle (TCA cycle)
    DY252_13185
   00620 Pyruvate metabolism
    DY252_13185
Enzymes [BR:tii01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DY252_13185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 QRPTase_N DUF2118 ATP-synt_ab_Xtn Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AXO15073
LinkDB All DBs
Position
complement(2751145..2752482)
Genome map
AA seq 445 aa AA seqDB search
MPVKVLMPALSPTMTEGTLAKWHVKEGDTVESGDVIAEIETDKATMEVEAVDEGKIGKIL
VSEGSENVAVNEVIALLLEEDEDESALEGADTSAASTSGGSESAPAKDDAKEEKAPAAAE
KSASGDDKPAPAAPVSGGKRIKASPLARRIAANEGVELSDVSGSGPRGRIVKRDIEAALS
SKPAEKSAASEDKKSADAPAAASAPAASGWNPDLTGLPEYEEIPNSGMRKTIARRLTESK
QQVPHFYLTVDCELDNLLATRKQLNEKAGEGVKISVNDFVIRAVSLALKKVPAANSIWTD
KATLQCKKQDISVAVAIEGGLITPVVRDAGSKGLAEISSEMKALAGKARDGKLKPEDYQG
GTFSVSNLGMFGIKDFSAIINPPQGCILAVGAGEQRPVVKDGALAIATVMTCTLSVDHRA
VDGAVGAEFMAEFKKLIEDPLSMLL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaaaagtattgatgccggccttgtcgccgaccatgaccgaaggcaccttggcg
aaatggcacgtcaaggaaggcgacaccgttgaatcgggtgacgtcatcgccgaaatcgaa
accgacaaagccacaatggaagtcgaagccgtcgacgaaggcaagatcggtaaaatcctt
gtttctgaaggcagcgaaaacgttgcggtaaacgaagttatcgcgttgctgcttgaagaa
gacgaagacgaaagcgcgcttgagggtgcggacacgtctgctgctagcacgtctggcggc
agtgaaagtgcgccggccaaggacgacgccaaagaggaaaaagcaccagcagcagccgaa
aaatcggcttctggtgacgacaagccggcaccggctgccccggtttccggtgggaagcgc
atcaaggcaagcccgcttgcgcggcgaattgccgccaacgaaggtgtcgagctttctgat
gtttccggttcgggcccgcgtggtcgtatcgtgaaacgagacatcgaagcggctctgtcg
tcgaaaccggccgaaaaatcggccgcatccgaagacaagaaatcggcagatgcaccggca
gcagcaagtgcaccggccgcatctggctggaacccggatcttaccggtcttccggaatac
gaagaaatcccgaacagcggcatgcgcaaaaccatcgcgcgtcgcctgaccgaatccaag
cagcaggttccgcacttctacctgacggtggattgcgaactcgacaatctgttggccacc
cgcaagcagctcaatgaaaaggcgggcgagggtgtcaagatttcggtcaatgatttcgtc
atccgtgcggtttcgctggcgctgaaaaaggttccggctgcgaactccatctggaccgac
aaggcgaccctgcagtgcaagaaacaggatatctcggtggcggttgccatcgaaggtggc
ctgatcacgccggttgttcgtgatgccggttcgaaaggccttgctgaaatctcaagcgag
atgaaggcactggctggcaaggcacgcgacggcaagctgaagccggaagattatcagggc
gggaccttctcggtctccaacttgggtatgttcggtatcaaggacttctcggcgattatc
aatccgccgcagggctgcatccttgcagttggtgcgggtgaacagcgcccggtcgtcaag
gacggtgcactggcaatcgccactgtcatgacctgcaccctttctgttgaccatcgcgcg
gtcgatggcgcagtcggtgcggaattcatggccgaattcaaaaagcttattgaagatccg
ctgagcatgttgctctag

DBGET integrated database retrieval system