KEGG   Thalassospira indica: DY252_13825Help
Entry
DY252_13825       CDS       T05581                                 

Definition
(GenBank) ArgE/DapE family deacylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
tii  Thalassospira indica
Pathway
tii00220  Arginine biosynthesis
tii01100  Metabolic pathways
tii01110  Biosynthesis of secondary metabolites
tii01130  Biosynthesis of antibiotics
tii01210  2-Oxocarboxylic acid metabolism
tii01230  Biosynthesis of amino acids
Module
tii_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:tii00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    DY252_13825
Enzymes [BR:tii01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     DY252_13825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AXO15185
LinkDB All DBs
Position
2891886..2893172
Genome map
AA seq 428 aa AA seqDB search
MTDFDRAALREAVSKRTQSAIDDLCALVRHDSLLGNEASAQDWIANKFAAMGLDVERVKI
DISALRDQPGFSPPVIDGYDGRENVVGLHRPQNPTGRSLILNGHMDVVPTGPAEQWRFGP
FTPHVEDDWIYGRGAGDMKAGIIAYCQALQALHDIGLEPAAPVTLQSVIEEECTGNGALA
CLHAGYKADCAIIPEPFNQTLMTAQLGVMWFQIHVSGSPAHVLDTSAGSNAIEAAFGFFE
TLKEVEEIWNHPTHRHAAFGAHVHPVNFNLGKIEGGEWASTVPPVCTADIRVGFYPGMEL
EKVRETVEAVKQSALDNHPSCKGAKIEITYRGFQAEGCEMDINHPMMSMIGDIHQEVTGK
EIRNLASTATTDARFFQIYGNIPATCYGPKAERIHGIDERVSIASMMEVTEVLALFIADW
CGVQKRPT
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacagactttgatcgcgctgcccttcgcgaagctgtttcaaagcgcacccaaagtgcc
atagatgatttgtgcgcgctggtgcgtcatgacagcctgcttggcaacgaggcatcggca
caggactggattgccaacaagtttgctgcgatggggctcgatgtcgaacgggtcaagatt
gatatcagcgccttacgcgatcagccgggcttttccccgccggtgattgacggctatgac
gggcgtgaaaacgttgttggcctgcatcgcccgcaaaacccgaccgggcgcagcctgatc
ctcaatggtcatatggatgtcgtgccgaccggtccggcggaacaatggcggtttggtccc
tttaccccgcatgtcgaggatgactggatttacggccgtggtgcgggcgatatgaaggcc
gggattattgcctattgccaggcgcttcaggccctgcacgatattggccttgaacccgcc
gccccggtcaccctgcaatcggtgatcgaggaagaatgtaccggcaatggcgcactggcc
tgcctgcatgccgggtacaaggccgattgcgccatcattcccgaaccgtttaaccagacc
ctgatgaccgcccagcttggtgtcatgtggttccagatccatgtatcgggcagcccggca
catgttctcgatacctctgctggcagcaacgcgattgaggcggcctttggtttctttgaa
accctgaaggaagtcgaggaaatctggaaccacccgacccaccgtcatgcggcatttggt
gcgcatgtccatccggtgaacttcaatctgggcaagattgaaggcggcgaatgggcgtcc
accgtgccgccggtttgcaccgctgatatccgtgttgggttctatccgggcatggagctt
gaaaaggtgcgcgaaaccgttgaggccgtgaagcaaagcgcgcttgataaccacccttcc
tgcaaaggggccaagatcgagatcacctatcgcggttttcaggccgaaggctgcgagatg
gatatcaatcatccgatgatgtcgatgattggcgacattcatcaggaagtgacaggcaag
gagatcagaaaccttgcctcgaccgcgacgaccgatgcgcgctttttccagatttatggc
aacatcccggcgacttgttatggccccaaggccgaacgcattcacgggattgatgaacgg
gtttcgattgcatccatgatggaagtcaccgaggtgcttgccctgttcattgccgactgg
tgcggtgtgcaaaagcgtcctacctaa

DBGET integrated database retrieval system