KEGG   Thiomonas intermedia: Tint_0660Help
Entry
Tint_0660         CDS       T01227                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
tin  Thiomonas intermedia
Pathway
tin00550  Peptidoglycan biosynthesis
tin01100  Metabolic pathways
tin01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tin00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tint_0660
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Tint_0660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tin01003]
    Tint_0660
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tin01011]
    Tint_0660
Enzymes [BR:tin01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Tint_0660
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Tint_0660
Glycosyltransferases [BR:tin01003]
 Polysaccharide
  Bacterial polysaccharide
   Tint_0660
Peptidoglycan biosynthesis and degradation proteins [BR:tin01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Tint_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB DUF2613
Motif
Other DBs
NCBI-ProteinID: ADG30060
UniProt: D5X6D3
LinkDB All DBs
Position
complement(712377..714746)
Genome map
AA seq 789 aa AA seqDB search
MSSSSTASPSPTPRPRARSPWWLRALIGLVVTVVGLLIAAALVVGLVLALSWPRLPDISE
LQNYQPQLPLRVYSADNALLGEFGEERRVFMPIGQIPDLMKKAVLATEDDRFYQHGGIDW
PGVARALLANLERSRSQGASTITMQVARNFYLSRDKTFTRKLFEVLLALKIEQQMSKDQI
LQLYMNQIFLGRKAYGFAAAAQAYFAKPLDQLSLAQMAMLAGLPKAPSAYNPISNPQRAR
QRQLHVIARLQQLRWITPTQAQQARDEPLALRTAQTENNLHAGYITETVRQMVFDRYHEA
AYTRGLNVYTTIRLRDQLAAWRSVQSGVLSYELRQPYRGPDAFIDLPGAVDAIPGAIEQA
CADRLAADDMVCSVVLSAKPAEVKVMTEAGQIVTVSGAGLRQVRALGLSDKAQPAIKLRA
GAVVWLAEDGPGQWVITQLPQVQSAFVSMNPNNGAIVSMVGGLDFARNKFNHATQAWRQP
GSSFKPFIYSAALEKGITPLTVVNDAPIFFSAAQTGGESWEPKNYDGKYEGPISLRRAVA
QSKNMVAIRVLDHIGPKFAQTWSTRFGFEASRQPPYLTLALGAGTVTPLQMARAYSVFAN
GGYLLKPFLISKITDSQGQVLFQDRPQQAGDEKLRVISPRNAYVMDSLLQEVTRSGTAAR
AQATLKRPDLYGKTGTTNDFLDAWFCGFQPSLVGVAWVGYDTPKKLGNKETGGALALPIW
IRYMQTALQNVPVASYAQPPGIVVENGEPVYSNFANGGGVASLGLDAPLPPPEVTRQERD
SILDLFKGN
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgagttcttcctctaccgcctcgccctctccgacgccgcgcccgcgcgctcgctctccc
tggtggctgcgcgccctgatcggcctggtggtcacggtcgtggggctgctgatcgcggcc
gcgctggttgtggggctggtgctggcgctcagctggccgcgactgcccgacatctcggaa
ttgcagaactatcaaccccagttgccgctgcgggtgtattcggcggacaacgcgctgctg
ggcgagtttggcgaggagcgccgggtgttcatgcccattgggcagattcccgatctgatg
aaaaaagcggtgctggccaccgaagacgaccggttctatcagcacggcggcatcgattgg
cccggggtggctcgcgcgctgctggcgaatctggagcgctcgcgcagtcagggcgcctcg
accatcaccatgcaggtggcgcgcaatttttatctgtcgcgcgacaagaccttcacccgc
aagttgttcgaggtgctactggcgctgaagatcgagcagcagatgagcaaggaccagatt
ctgcagctttacatgaatcagattttcctcggccgcaaggcctacggttttgccgcggcc
gcgcaggcttatttcgccaaaccgctcgaccagctctccctggcgcagatggcgatgctg
gcaggcctgcctaaagcgccctcggcttacaaccccatcagcaacccgcagcgggcgcgg
caacgccagttgcatgtgatcgcgcggttgcagcaactgcgctggatcaccccgacgcag
gcgcaacaggcgcgggacgagccgctggcgctgcgcaccgcgcagacggagaacaacctg
cacgcgggctacatcacggagacggtgcgtcagatggtgttcgaccgctaccacgaagcc
gcctacacgcgaggattgaatgtttacaccaccatacgcttgcgcgatcaactggcggcc
tggcgctcggtgcaaagcggcgtactgtcttatgagttgcgccagccgtatcgcggacct
gacgccttcatcgatctaccaggtgcggtggacgcgattcccggagcgatcgaacaggcc
tgtgccgaccgacttgctgccgacgacatggtgtgcagcgtggtgctcagcgcaaagccc
gccgaagtaaaagtgatgaccgaggcgggacagatcgtgaccgtctcaggcgcggggttg
cgacaggtgcgcgcactcgggctgtcggacaaggcgcagcccgccatcaagctgcgcgcc
ggggcggtggtgtggctggcggaggatgggccagggcaatgggtcatcacccaactacca
caggtgcagtcggccttcgtgtcgatgaacccgaataatggcgccatcgtttcgatggtg
ggcggcctggacttcgcgcgcaacaagttcaatcacgccacccaggcttggcgccaaccg
ggatcgagtttcaagcccttcatctactcggccgcactggaaaaaggcatcaccccgctc
accgtggtcaacgacgcgccgatatttttctccgcggcgcagacaggcggcgaatcgtgg
gagccgaaaaattatgacggcaaatacgaggggccgatcagcctgcggcgtgccgtggca
cagtcgaagaatatggtggccatccgcgtgctcgatcacatcggcccgaagttcgcgcaa
acctggagcacccgttttggcttcgaggccagccgccagccgccttacctcaccttggcg
ctgggcgcgggcacggtcacgcccttgcagatggcgcgtgcgtacagcgtgtttgccaac
ggcggctatctgctcaagccttttttgatcagcaagatcaccgattcccaagggcaggtg
ctgtttcaggatcggccgcagcaagcgggcgatgaaaaactgcgggtgatttcgccgcgc
aacgcctacgtcatggacagtctgctgcaggaggtcacgcgctcgggcacggcggcgcgg
gcgcaggcgacgctcaagcgccccgacctttacggcaagacgggcacgaccaacgacttt
ctcgacgcctggttctgcggcttccagcccagcttggtgggcgtggcctgggtgggctac
gacacgccgaagaaactgggcaacaaggaaaccggcggtgcgctcgccctgccgatctgg
attcgctacatgcagacggctttgcagaacgtgccggttgccagctatgcgcaaccgccg
ggcatcgtggtggaaaacggcgagccggtgtacagcaacttcgccaatggcggcggggtt
gccagcctcggactggacgcgcccctgccgccgcccgaggtcacgcggcaagagcgcgac
tccatcctcgatctgttcaaaggcaattga

DBGET integrated database retrieval system