KEGG   Thiomonas intermedia: Tint_2351Help
Entry
Tint_2351         CDS       T01227                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
tin  Thiomonas intermedia
Brite
KEGG Orthology (KO) [BR:tin00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tint_2351
Enzymes [BR:tin01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Tint_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA Thioredoxin_3 FAD_oxidored HI0933_like DAO FAD_binding_2 AlaDh_PNT_C NAD_binding_8 Glutaredoxin NAD_binding_7 FAD_binding_3 Thi4 K_oxygenase GMC_oxred_N FMO-like
Motif
Other DBs
NCBI-ProteinID: ADG31700
UniProt: D5X4N6
LinkDB All DBs
Position
complement(2516026..2517615)
Genome map
AA seq 529 aa AA seqDB search
MLDDTLLSQLKAYLERVSQPFTLVASLDDSENAAQMRTLLEQIASLSDKISVRFDGTDAR
RPSFALERVSGPAQHLRFAAIPLGHEFTSLVLALLWTGGHPPKVEAETLEAIRQLDGDYR
FEVYMSLSCHNCPDVVQALSLMAVFNPRVQTVVIDGALYQSEVESRQIMAVPTVYLNGEL
FGSGRMDVEEIVAKLDSGSAQRDAAKLNAKAPYDVLIVGGGPAGAAAAVYAARKGIRVGL
AAERFGGQVNDTLAIENYISVLETDGPKFGMALEAHVRQYGVEILNQQRAEKLIPAEHQG
GLIGVQFAHGGRLQARSVILCTGARWRNVNVPGEAEYRNKGVAYCPHCDGPLFKGKRVSV
IGGGNSGVEAAIDLAGLVAHVTLLEFAPELRADAVLVSKLRSLPNVTIHTNAQTTEITGD
GSKVNGLTYTDRASGASHHLELEGVFVQIGLVPNTEWLKGVVELSRFGEIVVDAKGQTSV
PGVMAAGDVTTVPYKQIVIAAGDGAKAALSAFDYLIRTPAAQMAEAVAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgacaccctgctttcccaactcaaggcttacctggagcgcgtctctcagccg
ttcaccctggtcgcctctctggacgatagcgagaacgcggcgcagatgcgcaccctgctg
gagcagatcgcgagtctctccgacaagatttcggtgcggttcgacggcactgacgcgcgg
cgcccgtccttcgctctggagcgtgtctcgggcccggcgcagcatctgcggtttgccgcg
attcctctgggccatgaattcacctcgctggtgctggcgctgctgtggaccggcggccat
ccgcccaaggtcgaggctgagaccctcgaagcgattcgccagctcgacggcgactatcgc
ttcgaggtgtatatgtcgctgagctgccataactgtccggacgtggtgcaggcgctgtcg
ctcatggcggtgttcaacccgcgcgtgcaaacggtggtgatcgacggtgcgctgtatcag
agcgaggtcgagtcgcggcagatcatggcggtgcccacggtgtatctcaatggcgaactg
ttcggcagcgggcgcatggatgtggaggagatcgtcgccaagctcgacagcggctcagcg
cagcgcgacgcggccaagctcaacgccaaagcgccttacgacgtgctgattgtgggcggt
ggcccggctggcgcggcggccgcggtttacgcggcgcgcaagggcattcgcgtggggctg
gcagccgagcgtttcggcggacaggtcaacgacacattggcgatcgaaaactacatctcg
gtgctggaaaccgatggcccgaaattcggtatggcgctcgaagcgcatgtgcggcaatac
ggcgtggagattctcaatcaacagcgcgccgaaaagctcattcccgcggagcaccaaggc
gggttgatcggtgtgcagtttgcccacggtggccgccttcaggcgcgcagcgtcatcctc
tgcaccggcgcgcgctggcgcaatgtgaacgtgccgggcgaagccgagtaccgcaacaag
ggcgtggcgtactgcccgcattgcgatggcccgctgttcaagggcaagcgggtgagcgtg
atcggcggcggcaactcgggcgtggaagccgccatcgatctggcgggtctggtggcgcat
gtcactctgctggaattcgcgcccgagctacgcgctgacgcggtgctggtgagcaagctg
cgcagtctgcccaatgtcaccattcacaccaacgcgcaaaccaccgaaatcaccggcgac
ggcagcaaggtcaacggcctcacctacaccgaccgcgccagcggcgccagccatcatctg
gagttggagggcgtgttcgtgcagatcggcctggtgcccaacaccgagtggctcaagggc
gtggtcgaactcagccgattcggcgaaattgtggtggatgccaaaggccagacctcggtc
cccggcgtcatggcggcgggcgacgtgacgaccgtaccctacaagcagatcgtcatcgcc
gcgggtgatggcgccaaggccgcgctcagcgcctttgactatctcatccgcaccccggcg
gcgcagatggccgaagccgtggccgcctga

DBGET integrated database retrieval system