KEGG   Thiomonas intermedia: Tint_2977Help
Entry
Tint_2977         CDS       T01227                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tin  Thiomonas intermedia
Pathway
tin00480  Glutathione metabolism
tin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Tint_2977
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tin02000]
    Tint_2977
Enzymes [BR:tin01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Tint_2977
Transporters [BR:tin02000]
 Other transporters
  Pores ion channels [TC:1]
   Tint_2977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_2 GST_N_3 GST_N GST_C_2 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: ADG32312
UniProt: D5WZB4
LinkDB All DBs
Position
complement(3160719..3161333)
Genome map
AA seq 204 aa AA seqDB search
MKLFYSPGACSLSPHIVLHELGLPHDVVKVDLKTKQTSDGRDFRTINPKGYVPTLQLDDG
TILTEGPAIVQYLADRKPEMHLAPANGTLARYQLQEWLNFISTELHKQFSPLFNPASSAD
LIAAQKARLAERFALIAQTLEQHDYLLPSGFSVADAYLYTILTWAGFVGVDLSPWPALVR
YKARMEARPGVAATLAAEREAKKG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttctacagccccggcgcctgctcgctctcaccgcacatcgttctgcacgag
ctcggcctgccgcatgacgtggtcaaggtcgatctcaagaccaagcagactagcgatggg
cgcgacttccgcaccatcaaccccaagggctatgtgcccaccctgcaactcgacgatggc
accatcctcaccgaaggcccggccatcgtgcaatacttggccgatcgcaaacccgaaatg
catctcgccccggccaacggcacgctggcgcgctatcagttgcaggaatggctgaacttc
atctccaccgagctgcacaagcagttcagcccgttgttcaacccggccagcagcgccgac
ctgatcgccgcgcagaaggccaggctggccgagcgcttcgccctgatcgcccagaccttg
gagcaacacgactacctgctgcccagcggcttcagcgtggccgatgcctatctctacacc
atcctgacctgggccggttttgtcggcgtggacctgtcgccctggcccgccttggtgcgc
tacaaggcgcgcatggaagcgcgccccggcgtggctgccaccctggcggccgaacgcgag
gcgaaaaagggctga

DBGET integrated database retrieval system