KEGG   Thermoanaerobacter italicus: Thit_0471Help
Entry
Thit_0471         CDS       T01178                                 

Definition
(GenBank) flagellar hook-associated protein 3
  KO
K02397  flagellar hook-associated protein 3 FlgL
Organism
tit  Thermoanaerobacter italicus
Pathway
tit02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:tit00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    Thit_0471
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:tit02035]
    Thit_0471
Bacterial motility proteins [BR:tit02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    Thit_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellin_N Flagellin_C MnmE_helical NdhM Snapin_Pallidin DELLA
Motif
Other DBs
NCBI-ProteinID: ADD01778
UniProt: D3T746
LinkDB All DBs
Position
517855..518748
Genome map
AA seq 297 aa AA seqDB search
MRVTDGMLITNFLNNYHNNLEKLQKNQNMLSTGKKISRPSDDPVAVATSLRIRTDMARND
AYTKNADEVQSWLNITDTALDQLGDLLQRTRELAVEGANGTLTQADMQKIAKEIEQLKAQ
MIQVGNTQYNGRYIFAGFKTTTQPFSEDNNSYNGDNGLIEFEVGAGGNKISVNVPGDKVF
DVDLTGTSQLLVMMDNLKSALDSGDHQAVSNLIADVDRQLENVLAVRAEVGAKSNRVDLI
KNRLQDDNYNFTVLLSKNEDADLAQVITNLKMDENVYRASLAAGARIMQPSLIDFLR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagagttactgatggtatgcttataacaaattttttaaacaattatcacaataacctt
gaaaagttacaaaaaaatcaaaacatgttatctacaggcaagaaaatatcaagaccttct
gatgaccctgtagcagtagctacaagcttgcgcattcgaacagatatggcaagaaatgat
gcttatactaaaaatgctgatgaggtccagtcttggttgaacataactgatactgcttta
gaccagttaggagacttattacagcgcacgagagaattagcagttgagggtgccaatggt
actttaacacaggccgatatgcaaaaaatagctaaagagatagagcagttaaaagctcaa
atgatacaagtagggaatacacaatacaatggaaggtatatatttgcaggctttaaaaca
accacacagcctttcagtgaggataacaattcttataatggtgataatggtttaatagag
tttgaagtaggcgcagggggaaataaaatatctgtaaatgtaccgggagataaagttttt
gatgtagatttgacaggaacttctcaacttcttgttatgatggataatctaaaaagcgct
ttagactcaggagatcatcaggctgtaagcaatttaatagctgatgtggatagacaacta
gaaaatgtactggcagtaagagcagaagttggtgcaaaatcaaacagggttgaccttata
aaaaacaggctccaagatgataactacaattttacagttcttctttcaaaaaatgaagat
gcagatttggcacaagttattacaaatctcaagatggatgaaaatgtatatagagcatca
ctagctgcgggagctcgtattatgcaacctagtcttatagattttttaaggtga

DBGET integrated database retrieval system