KEGG   Thermoanaerobacter italicus: Thit_0472Help
Entry
Thit_0472         CDS       T01178                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD01779
UniProt: D3T747
LinkDB All DBs
Position
518753..519310
Genome map
AA seq 185 aa AA seqDB search
MNIVINQTFGRIGIDTTPAQISIQSPKADLEIKQIPAKMEIDKKLPQVHIDQYQCFYEAG
LKSIFDLVYDEAQRSKQIALEAIGKIAEDGDILASIENHQDAIVKLSEEALIQDIDFNVD
LIPKSRPKIWFEGYLKINWELGGVKIKAIPHKPQISVTPAHVNIYMRQYPSIKIQYVGNN
VDRRI
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagtgataaatcaaacttttggcaggataggtatagacactactcctgcccaa
atttctatacaaagcccaaaagcagaccttgaaataaaacaaatacctgcaaaaatggaa
atagacaaaaaacttccgcaagtgcatatagaccaatatcagtgtttttatgaagcaggg
cttaaaagtatttttgaccttgtatatgatgaagcccagaggagcaaacaaatagctctt
gaggcaataggcaaaattgctgaagatggagacatacttgcatcaatagaaaaccatcaa
gatgcaattgtaaagttaagtgaagaagccctgattcaagatatagacttcaatgttgac
ctcattcccaaatcacgacccaaaatatggtttgaaggatatttaaaaataaattgggag
ttaggcggtgtaaaaatcaaagcaatacctcataagcctcaaatatctgtgacaccggca
catgtaaatatatatatgaggcaatacccatcaataaagatacaatatgtaggaaataat
gtcgatagaaggatatga

DBGET integrated database retrieval system