KEGG   Thermoanaerobacter italicus: Thit_1813Help
Entry
Thit_1813         CDS       T01178                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00340  Histidine metabolism
tit01100  Metabolic pathways
tit01110  Biosynthesis of secondary metabolites
tit01230  Biosynthesis of amino acids
Module
tit_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tit00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Thit_1813
Enzymes [BR:tit01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     Thit_1813
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Thit_1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG SH3_1 DUF3239 SH3_9
Motif
Other DBs
NCBI-ProteinID: ADD03056
UniProt: D3T4A4
LinkDB All DBs
Position
complement(1848627..1849286)
Genome map
AA seq 219 aa AA seqDB search
MIDIEELKFDEKGLIPAIVQDYNTKQVLMLAYMNEESLKLSLEKGETYFFSRSRKEIWHK
GETSGNTQKIKNIFYDCDGDALLIEVEPKGPACHTGNVSCFYRSFLGEVENYDMEILKML
YERVKDRKTNPAEGSYTNYLFEKGIDKILKKIGEETTEVVIASKNDSKEEIVYEVSDLLY
HLIVLLVDKGIKLEDVYGELGRRYYKPKEFKEEHKERKK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgattgatatagaggaattaaagtttgatgaaaaaggacttattcctgcgattgtgcaa
gactacaatacaaaacaagtattaatgttggcttatatgaatgaggaaagtttaaaatta
agcttggaaaagggagaaacttatttttttagcagaagtagaaaggaaatttggcataaa
ggggaaacttcaggtaatacccaaaagataaaaaacatattttatgactgcgatggggat
gctttgctaattgaggtggagccaaaagggccggcatgccatacagggaatgtaagctgt
ttttataggagctttttaggtgaagttgaaaattatgacatggaaatacttaaaatgcta
tatgaacgggtaaaagatagaaagacaaacccggcagaagggtcttatactaattatttg
tttgaaaaaggcatagataagattttaaagaaaattggcgaagaaactacggaggtagtg
atagcttccaaaaatgactccaaagaagagatagtgtatgaggtttcagatttactttat
catttaatagttttgttagttgacaaaggtataaagctcgaggatgtatacggtgagctt
ggcagaaggtattataagccaaaggaatttaaagaagaacataaagagagaaagaaatag

DBGET integrated database retrieval system