KEGG   Thermoanaerobacter italicus: Thit_2216Help
Entry
Thit_2216         CDS       T01178                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00473  D-Alanine metabolism
tit00550  Peptidoglycan biosynthesis
tit01100  Metabolic pathways
tit01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tit00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Thit_2216
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Thit_2216
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Thit_2216
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tit01011]
    Thit_2216
Enzymes [BR:tit01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Thit_2216
Peptidoglycan biosynthesis and degradation proteins [BR:tit01011]
 Precursor biosynthesis
  Amino acid ligase
   Thit_2216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: ADD03427
UniProt: D3T5Q4
LinkDB All DBs
Position
complement(2261124..2262203)
Genome map
AA seq 359 aa AA seqDB search
MVKKRIAVLFGGQSGEHEVSLMSAKSIINNLDKDKYEIYMVGITKKGEWYLYRGDVEKIE
TGEWEKEGIPATMGASTKYRGIITFGEGKNGFFPIDVVFPVLHGPNGEDGTIQGLLELLN
IPYVGANVLSSALCMDKVFTKRIFKEAGLPTPDFVVVYRKEIGDLETIKKKIEHLGYPCF
VKPANLGSSVGITKVHNEEELPGALKLAAKYDRKLLIEKGIEAREIECSVLGNENPEASV
AGEIVPSNEFYDYNAKYFDGGKSLLLIPAPLPDEKMEEIRKLAIKAYKALDLRGMARVDF
LMDRNTGTVYLNEVNTIPGFTKISMYPKLWEASGKSYSALLDDLINLAIESNNEKCREW
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagaagagaattgctgttttatttggaggacaatcaggagaacatgaggtctct
ttaatgtctgcaaagtctataataaacaatctcgataaagataaatacgagatttacatg
gtaggtattacaaaaaaaggagaatggtatctatataggggtgacgtagagaaaatagaa
accggagaatgggaaaaagaaggaattcctgcaactatgggagcttctacaaagtataga
ggaataataacttttggagaaggaaaaaatggtttttttcctatagacgtggtatttcct
gtattgcatggccctaatggggaagatgggactatacaagggcttttagaattattgaat
ataccttatgtaggtgctaatgtgctttcttctgctttatgcatggataaagtttttaca
aaaagaatttttaaggaagctggattgcctacacctgattttgtagtagtttatagaaaa
gaaattggggatttagaaactattaaaaagaaaattgagcacttaggatatccttgtttt
gtaaaaccagctaatttgggatcaagtgttggtattaccaaagttcacaacgaggaagaa
cttcctggggccttgaaattagctgcaaaatatgatagaaaattgttgatagaaaaagga
atagaggccagagagattgaatgctctgttctggggaatgaaaatcctgaggcttctgtt
gcgggagaaattgtaccttcaaatgagttttatgattacaatgcgaaatattttgatgga
gggaagtcacttcttttaatacctgctccactacctgatgaaaaaatggaagagataaga
aagcttgctataaaagcctacaaagccttggatttaagaggcatggcgagagtagacttt
ttaatggatagaaatacaggcactgtttacctaaatgaagttaacactattccgggcttt
acgaaaataagcatgtatcctaaactatgggaagcaagtggaaagtcctattcggcatta
ttggatgaccttataaatttagcaatagaaagtaataatgaaaaatgtagggaatggtga

DBGET integrated database retrieval system