KEGG   Tenacibaculum jejuense: TJEJU_1257Help
Entry
TJEJU_1257        CDS       T05041                                 

Gene name
susA
Definition
(GenBank) Candidate alpha amylase precursor. Glycoside hydrolase family 13
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
tje  Tenacibaculum jejuense
Pathway
tje00500  Starch and sucrose metabolism
tje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TJEJU_1257 (susA)
Enzymes [BR:tje01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     TJEJU_1257 (susA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1939 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: SNR14997
UniProt: A0A238U760
LinkDB All DBs
Position
TJEJU:1327886..1329271
Genome map
AA seq 461 aa AA seqDB search
MKTLFKFLIILLFINYSCSNNEAGVDSVIDETSSQNSSEKKLKARQGLKPIGTGVMMQAF
YWDVPAGGTWWEKVESKVQSWSDAGIDAIWLPPVSKAQNGAFSMGYDPFDYYDFGQYNQM
GSVETRFGSKTELESLINKAHNAKLSVIADIVINHNSGGELEDNPYTGTPYYTDFNPKSG
KFFRTNSDFHPNANCNSDSGVFGGFPDLSHCQPYVQDWLWKRSNSVAKYYKNVMGFDGWR
FDYVKGFEPWVVREWKNAVGGFSVGEYWDGNASTLDWWSGEAQVSAFDFACYYRMRDAFQ
GNDLNKLKGDMLWKRNSRKAVTFVANHDTDEIYNGKLLAYAYILTHEGYPTIFYRDYEEW
LSKTKLKNLIWIHNNLAGGSTSILHVDNDEYVARRNGHNNAGLVVYINNSNSWKERWIET
NWSNTRIKDYTGNSNWQPVTQGGKWVKVQAPPKSYTVWSPK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactctttttaaatttttgataatactattatttatcaattattcttgctcaaat
aatgaagcaggggtagattcagttatagatgaaacttcatcacaaaatagttcagaaaaa
aaactgaaagccagacaaggtttaaaacctatcggtacaggtgttatgatgcaagctttt
tattgggatgttccagcaggtggtacttggtgggaaaaagtagaaagcaaagttcaaagt
tggagtgatgctggaatcgatgctatttggctaccaccagtatcaaaagcacaaaacgga
gctttttcaatgggatatgatccttttgattattatgattttggtcagtacaatcaaatg
ggaagtgtggaaacacgttttggttcgaaaactgaactagaaagtttaattaataaagcg
cacaatgcaaaattaagtgtaattgcagatatcgtaatcaatcacaatagtggaggagaa
ttagaagacaatccatatactggtacaccatattatacagattttaatccgaaatcagga
aagttttttagaactaacagtgattttcatccaaatgcaaattgtaatagtgattcaggg
gtatttggaggttttccagatttaagtcattgtcaaccctatgtgcaagattggctatgg
aagagatctaacagtgtagctaaatattataagaatgttatgggattcgatggttggaga
ttcgactatgtaaaaggttttgaaccatgggtagtaagagaatggaaaaatgcagtaggc
ggattttcagtaggagagtattgggatggtaatgcaagtactttagattggtggtcaggt
gaagcacaagtttcagcttttgattttgcgtgttattacagaatgagagatgcttttcaa
ggcaatgatttaaataaattaaaaggagatatgctttggaagagaaattctagaaaagca
gttacattcgtagcaaatcatgacacagatgaaatttataatggaaaattattagcttat
gcttacattttaactcatgaagggtatccaactattttttatagagattacgaagaatgg
ctaagtaaaacaaaattgaagaatttaatttggattcataataatcttgcaggtggaagt
acatctatccttcatgtagataacgatgagtatgtagcaagaagaaatggacacaataat
gctggtttagtagtttatataaataattctaattcttggaaagaaagatggattgaaacg
aactggtctaatacaagaataaaagattatacaggaaattcaaactggcaacctgtaact
caaggaggaaaatgggttaaagttcaagcgccacctaaaagttatacagtttggtcacca
aaataa

DBGET integrated database retrieval system