KEGG   Tenacibaculum jejuense: TJEJU_2363Help
Entry
TJEJU_2363        CDS       T05041                                 

Gene name
gcvT
Definition
(GenBank) Aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
tje  Tenacibaculum jejuense
Pathway
tje00260  Glycine, serine and threonine metabolism
tje00630  Glyoxylate and dicarboxylate metabolism
tje00670  One carbon pool by folate
tje01100  Metabolic pathways
tje01110  Biosynthesis of secondary metabolites
tje01130  Biosynthesis of antibiotics
tje01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TJEJU_2363 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TJEJU_2363 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    TJEJU_2363 (gcvT)
Enzymes [BR:tje01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     TJEJU_2363 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG DUF3659
Motif
Other DBs
NCBI-ProteinID: SNR16048
UniProt: A0A238UBU9
LinkDB All DBs
Position
TJEJU:2593976..2595058
Genome map
AA seq 360 aa AA seqDB search
MKNTALSHVHEALGAKMVPFAGYNMPVQYEGVNIEHETVRKGVGVFDVSHMGEFFLKGEN
ALALIQKITTNDAAKLVPGKAQYTCMPNNTGGIVDDLIIYMIQENEYMLVVNASNIEKDW
NWISQHNDLNVEMENRSEDWSLLAIQGPKAAEAMQSLTKVDLSAIKFYTFEITDFAGIPN
VVVSATGYTGSGGFEVYVKNEDVEALWKKVFEAGADWDIKPIGLAARDTLRLEMGYCLYG
NDITDTTSPIEAGLSWITKFSKDFVNAEALKAQKENGVSRKLVAFELTERGIPRKDYEIV
DTSGEVIGEVTSGTMSPSLGKGIGLGYVTIENSKVDSDILIQIRKKQIPAKVVKLPFYKG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatactgcgttatcacatgtacatgaagctcttggtgcaaaaatggttccattt
gctggatataatatgcctgtgcaatacgaaggtgtaaatattgaacatgaaacggttaga
aaaggtgttggtgtttttgatgttagccatatgggagaattttttcttaagggagaaaat
gctttagctttaattcaaaaaattacaactaatgatgctgctaagttggttcctggaaaa
gcgcaatatacatgtatgccaaacaatacaggtggaattgtagatgatttaattatctac
atgattcaagaaaatgaatacatgttagttgttaatgcatctaacattgaaaaggattgg
aactggatttctcaacataatgacttaaatgttgaaatggaaaatagatctgaagattgg
tctttacttgcaattcagggtcctaaagctgccgaggctatgcaatctttaactaaggtt
gatttatctgctatcaagttttatacattcgaaattactgattttgctgggattccaaat
gtagtggtttctgctactggttatacaggttctggcggatttgaagtatatgtaaaaaat
gaagatgtagaagcattatggaaaaaagtttttgaagctggagcagattgggatattaaa
cctatcggattagcagctcgtgatacgctacgtttagaaatgggatattgtttatacggt
aatgatattactgatacaacttctcctattgaagctggtttaagttggattactaaattc
tcgaaagattttgtaaatgctgaagctttaaaagctcaaaaagaaaatggtgtttctaga
aagttagttgcttttgagctaactgaacgtggaattcctagaaaagattatgagattgta
gatacaagcggagaagtaatcggtgaagtaacttcaggaactatgagtccgagtttaggt
aaaggaattggtttaggatatgttaccattgaaaattctaaagtagattctgatatctta
atacagatacgaaaaaaacaaattcctgctaaagtggttaaattgcctttttataaagga
taa

DBGET integrated database retrieval system