KEGG   Tenacibaculum jejuense: TJEJU_2372Help
Entry
TJEJU_2372        CDS       T05041                                 

Definition
(GenBank) Protein of unknown function precursor containing a C-terminal secretion signal. Putative glycoside hydrolase family 13
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
tje  Tenacibaculum jejuense
Pathway
tje00500  Starch and sucrose metabolism
tje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tje00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TJEJU_2372
Enzymes [BR:tje01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     TJEJU_2372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM26 Alpha-amylase Alpha-amyl_C2
Motif
Other DBs
NCBI-ProteinID: SNR16057
UniProt: A0A238UA35
LinkDB All DBs
Position
TJEJU:2603951..2606569
Genome map
AA seq 872 aa AA seqDB search
MKQTLKILQLALVFFFAWNIQAQDEDVMFQAFDWNVQNQPAGQTWFNVVTQNSAEISSAG
VDLIWLPPVSDSAAPQGYLPRELYNFNSAYGTEAQLRGLINQYHSLGMKIIGDIVINHRV
GTRDAVTFTNPAWPTTFITADDEGRNFVNFPVEFSINSDYFPGTALKADGSNGTYGPARD
LDHRNPAVRQEIKNWMNFLKNDLGFDGWRYDFVHGYDPIYNKEYNDATQPYFAVGELLES
SRVQTNNWVNFTQQSSSAFDFNTKVTLQDAIRDNNMSYLRDGQGRPSGMIGINPGKSVTF
LDNHDTGFAQQCCGSNYVFPGGETNLRKGYAYILTHPGNPMIFWTHYFDAGNGVRQAIKD
LIAIRKDVRIFASSSINIAEARNDVYAAYIDGRNGTIAMKLGGGNWSPQGSGWTLRTSGT
DYAVWTKGGTVTPPPPPPAQVDPFTVNFKKPSGWGNNVNVYLFDASTNAIIPGTSGWPGQ
SATNINGTPWYSLQVNPPSGVAAQNIRVIFNDGTNQTDDLSRSTNGWYDNGTWTNNCPSD
CSGNPNPPNTNTRFTVNFKKPNGWGNNINAYFFDAGSNTTISGTAGWPGQSTTNISGTPW
YSYEVAIPAGTSLSNVRVIFNDGSNQTDDLTRSSTGWYDNGTWTNNCPSNCSGTTTPPPS
NNNVTLNFLRTSSWGNTVNVYLYNTNTNSTLAGTPAWPGRTMQNQASTSWSSTSFTLPSN
VSPNNVGVVFNNGNGQQTVDLNRGTSGWFRITGSSSGKATGVWSNSCPTGCISSRQIATS
TTDLITENSVRIAPNPIHQNGNLFITTTQKGVLKVSIMNLLGQSKTVYEKTNNAGNHTIE
LNNNDFGAKGIYIISTTLDNVNITKPIKVIKN
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaccctaaaaattttacaacttgctttagtatttttctttgcatggaatata
caagcgcaagacgaagatgtaatgtttcaagctttcgattggaatgttcaaaatcaacca
gctggacaaacttggttcaatgttgtcactcaaaatagtgctgaaataagtagtgctggt
gtcgatttaatttggttacctccagtaagtgattctgctgcgccacaaggatatttacca
agagaattgtataacttcaatagtgcttatggtacagaagctcaattaagaggtttaatt
aatcaatatcatagcttaggaatgaaaattattggagatattgtaattaaccatagagtt
ggtactagagatgctgttacttttacaaatcctgcttggccaacaacatttattactgcc
gatgatgaaggaaggaactttgtaaactttcctgtagagttcagtatcaattctgattac
ttccctggtacagctttaaaagctgatggatcaaatggaacttatggtccagctagagat
ttagatcatagaaatcctgctgtaagacaagaaataaaaaactggatgaatttcttaaag
aatgatttaggattcgacggttggagatatgattttgttcatggatatgatccaatatat
aacaaagaatataatgatgctacacagccttactttgctgtaggagaattattagaaagt
agtagagttcaaacaaacaactgggtaaactttacacaacagtcttcttctgcatttgac
tttaatactaaagttactttacaagatgctattagagacaacaatatgtcgtatttaaga
gatggacaaggaagaccttctggtatgattggtattaatccaggaaaatcggtaacattc
ttagataatcacgatactggttttgcacaacaatgttgtggttctaactatgttttccca
ggtggtgaaacaaacttaaggaaaggatatgcttacattctaactcacccaggtaaccca
atgattttctggacacattattttgatgctggaaatggtgtaagacaagcaataaaagat
ttaatagcaattagaaaagatgtaagaatttttgcaagttcatctattaatattgctgaa
gcaagaaacgatgtttatgcagcttacattgatggaagaaatggaacgattgcaatgaaa
cttggtggtggtaattggtctcctcaaggttctggttggactttacgtacttctggaaca
gattatgcagtttggacaaaaggcggaactgttacacctcctcctccacctccagctcaa
gttgatccttttactgtaaactttaaaaaacctagtggttggggaaataatgtaaatgta
tatttatttgatgcttctacaaatgctattattcctggaacttcaggttggccaggacaa
tcagctactaatattaatggaactccatggtattcattacaagttaatccaccttctggt
gtagcagctcaaaatattagagttatttttaatgatggaactaaccaaactgatgattta
agcagaagtactaacggttggtatgataatggaacgtggacgaataattgtccttctgat
tgtagtggaaatccaaatccaccaaatacaaatactagatttacagttaatttcaaaaaa
ccaaatggttggggaaataacataaatgcttatttctttgatgctggttctaatacaaca
atttctggaacggctggatggccaggacaatcaactacaaatatttcaggaacaccttgg
tattcttatgaagttgctattccagctggaacttcattaagtaatgttcgtgttatcttt
aatgatggaagtaatcaaactgatgatttaacaagaagctcaactggttggtatgataat
ggaacatggacaaataattgcccttctaattgtagtggaactactactccacctccgagc
aataacaatgttacattaaactttttaagaacatcttcttggggaaatactgtaaatgta
tatttatacaatacgaatacaaattctactttagctggaactccagcttggccaggtaga
acaatgcaaaatcaagctagtacttcttggtcttcaacttcgttcactttaccaagcaat
gtatctcctaataatgttggtgtcgtttttaataatggaaatgggcagcaaactgttgat
ttaaacagaggaacatcaggatggtttagaattactggaagttcaagtggaaaagctaca
ggagtttggtctaattcatgtcctacaggatgtatatcttcaagacagatagcaacaagt
actactgatttaataacagaaaactcggtaagaattgctcctaacccaatacatcagaat
ggaaacttatttatcacgacaactcagaaaggtgttttaaaggtttctatcatgaatcta
ttaggacaatctaaaacagtgtatgaaaaaactaataatgcaggaaatcatacaattgaa
ttaaataataatgattttggagctaaaggaatttatattatctcaactactttagataat
gtaaatataactaagccgataaaagtcataaaaaattaa

DBGET integrated database retrieval system