KEGG   Tenacibaculum jejuense: TJEJU_2956Help
Entry
TJEJU_2956        CDS       T05041                                 

Definition
(GenBank) putative oxidoreductase
Organism
tje  Tenacibaculum jejuense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C Pyr_redox Pyr_redox_2 2-Hacid_dh_C HI0933_like ADH_N_2 3HCDH_N UDPG_MGDP_dh_N TrkA_N
Motif
Other DBs
NCBI-ProteinID: SNR16625
UniProt: A0A238UC43
LinkDB All DBs
Position
TJEJU:complement(3313590..3314609)
Genome map
AA seq 339 aa AA seqDB search
MKATFYEGNKKLSLVDKEIEAPKEGDVRIKVAYAGVCGTDMHIYHGMMDGRVAIPLTIGH
EMSGTVDAVGKEVTDYKIGDKVVVRPLDDRLAKPSDKGFNHICEELKFIGIDSPGAMQQY
WNVPAFTLHKLPDTTDLKLAALVEPLSVATHDVRMSELKPNEYAVVLGGGPIGMLIALVA
KEMGANVIISEVNESRITKAKEMGLEAVSPIETDLVAYVKDKTEGRLADVVFEVAGVQST
LDIMTEISGIRGRIVMVAIHGQPKPVNLFKFFWKELKLIGARVYEKEDYEKSIQLINDNK
LPFSEMITGVESISKIQEVFEGIDKNPNGMKTLIDCQSV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaactttttacgagggaaataaaaaactgtctttagttgacaaagaaatagaa
gcaccaaaagaaggagatgtaagaataaaagtagcatatgcaggagtttgcggtacagac
atgcatatttatcatggaatgatggatggtagagtagctattcctttaactattggtcat
gaaatgtcaggtacagttgatgcagtaggaaaagaagttacagattataaaattggagat
aaagttgtcgttagacctttagacgatagactggctaaaccatctgataaaggttttaat
catatttgcgaagaattaaaattcataggtattgatagtcctggtgccatgcaacaatac
tggaatgttccagcttttacacttcacaaacttccagatacaacagatttaaaattagca
gcattggtagaaccactttctgtggcaacacacgatgttcgtatgagtgaattaaaaccg
aacgagtatgctgttgttttaggcggaggtccaatcggaatgctaatcgctttagtagca
aaagaaatgggagctaatgttattatttcggaagttaatgaaagtagaattacaaaggca
aaagaaatgggattggaagctgttagtccaatagaaacagatttggttgcttatgtaaaa
gataaaactgaaggaagattggccgacgtagtttttgaagttgccggagttcaatccaca
ctagatatcatgactgaaatatctggaatacgagggagaattgttatggtggcgattcat
ggccaacctaagcctgtaaatcttttcaagtttttctggaaagaattaaagctgatagga
gcaagagtttatgaaaaagaagactatgaaaaatcaattcaattaatcaatgataataaa
cttccattttcagaaatgattacgggagtagaatcaattagtaaaattcaagaagttttc
gaaggaattgacaaaaatcctaatgggatgaaaacattaatcgattgtcaatccgtataa

DBGET integrated database retrieval system