KEGG   Tenacibaculum jejuense: TJEJU_3739Help
Entry
TJEJU_3739        CDS       T05041                                 

Definition
(GenBank) Linoleoyl-CoA desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
tje  Tenacibaculum jejuense
Pathway
tje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tje00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    TJEJU_3739
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tje01004]
    TJEJU_3739
Enzymes [BR:tje01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     TJEJU_3739
Lipid biosynthesis proteins [BR:tje01004]
 Desaturase
  Front-end
   TJEJU_3739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DUF2207 HNH_2 DUF5313
Motif
Other DBs
NCBI-ProteinID: SNR17375
UniProt: A0A238UE95
LinkDB All DBs
Position
TJEJU:4170137..4171228
Genome map
AA seq 363 aa AA seqDB search
MNSIKFSRIDKTKFFRTLNKRVNDYFKENEIKRTGNWKLYLKAIIMFTLFLAPFAVILTV
DMPNWLRFLLTIVIGIGMAGVGMNVMHDSNHESFSSKKWVNNLMGSSMYILAGNVYNWKV
QHNVLHHTYTNIQDHDEDMDAGRIIRFSKHTQWRPFHRFQKYYSPVLYGLLTINWAITTD
FKQMHSYLKRKLSYGKFPNPKVEWTKLIVTKIIYYAMWLVLPLLVLDIAWWKVLIGFFVM
HYTAGIILSFVFQLAHIVPSTDTPLPDENGNMKNTWAIHQLYTTANFAPKNWFINFYTGG
LNHQVEHHIFPHISHIHYSKIAKIVKETAKEFNLPYHEYKTTRKAILEHLRHIAELGKKP
QLA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgattaaattttcaagaatagataaaaccaagttttttagaactttaaataaa
agagtaaacgactactttaaagaaaacgaaattaagagaacaggtaactggaaattgtat
ttaaaagcaattatcatgtttacacttttcttagctccttttgcagttatattaactgtt
gatatgcctaactggcttcgatttttattaacgattgttataggaattggtatggctggt
gttggtatgaatgtaatgcacgatagcaaccatgaatctttctcaagtaaaaaatgggtg
aataacctaatgggaagtagtatgtatattttagctggaaatgtgtataactggaaagtg
caacataatgttttacaccatacatatacgaatattcaagaccatgatgaagatatggat
gctggtagaattattcgtttttctaaacatacacaatggagacctttccatagatttcag
aagtattattcgccagttttatatggtttactaactattaactgggcgataactacagat
ttcaagcaaatgcacagctacttaaaaagaaaattatcttatggaaaattccctaatcca
aaagtagaatggactaaattaattgttactaaaattatttattatgcaatgtggttagtt
cttccattattggttttagacattgcatggtggaaagttttaattggtttctttgtaatg
cattatacggcaggaatcattttaagttttgtattccagttagcacacatcgtaccttca
acagacactcctttaccagatgaaaatggtaacatgaaaaatacttgggcgattcaccaa
ttgtatactacagcaaactttgctcctaaaaattggtttattaatttctacactggaggt
ttaaatcatcaagtagaacaccatattttccctcacatttcgcacatacattacagtaaa
atagcgaaaatagtaaaagagactgctaaggaatttaatttaccttatcacgaatataaa
acaacacgaaaggcaattttagaacacttaagacatattgccgaactaggaaaaaaaccg
caactagcataa

DBGET integrated database retrieval system