KEGG   Tenacibaculum jejuense: TJEJU_3836Help
Entry
TJEJU_3836        CDS       T05041                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
tje  Tenacibaculum jejuense
Pathway
tje00240  Pyrimidine metabolism
tje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tje00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    TJEJU_3836 (tdk)
Enzymes [BR:tje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     TJEJU_3836 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: SNR17468
UniProt: A0A238UFX6
LinkDB All DBs
Position
TJEJU:4262591..4263199
Genome map
AA seq 202 aa AA seqDB search
MFLENTVNHTEQFGWIEVICGSMFSGKTEELIRRLKRAKFAKQRVEIFKPAIDVRYDEEE
VVSHNDNRIRSTPVPASANIRLLANNVDVVGIDEAQFFDNEIVAVCNDLANRGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLAHYSFRKAESDNIVLLGETQEYEP
LSRAAYYKAIQEQNAQLKEEEE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacagtaaatcatacagaacagtttgggtggatagaggtaatttgc
ggctcaatgttttcggggaaaactgaggaattaattcgtagattaaaaagagcaaaattt
gccaaacaaagagttgaaatttttaaacctgctattgatgtaagatatgatgaagaggaa
gtagtttctcataatgacaatagaattcgatctacaccagtaccagcttctgcaaacatt
agattacttgctaataatgttgacgttgtaggaattgatgaagctcaattttttgacaat
gaaattgttgctgtttgtaacgatttagcaaatagaggaattcgagttattgtagcagga
ttagatatggattttaaaggaaatcctttcggtccaatgcctgctttaatggcaacagca
gaatatgtaactaaagttcatgcggtttgtacaagaaccggtaacttagcacattatagt
ttcagaaaagctgaaagtgataatattgtacttttaggcgaaactcaagaatacgaacca
cttagtagagctgcttactacaaagccatacaagagcaaaacgctcaacttaaagaagag
gaagaatga

DBGET integrated database retrieval system