KEGG   Thermincola potens: TherJR_0657Help
Entry
TherJR_0657       CDS       T01226                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tjr  Thermincola potens
Pathway
tjr00473  D-Alanine metabolism
tjr01100  Metabolic pathways
tjr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tjr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TherJR_0657
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    TherJR_0657
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tjr01011]
    TherJR_0657
Enzymes [BR:tjr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     TherJR_0657
Peptidoglycan biosynthesis and degradation proteins [BR:tjr01011]
 Precursor biosynthesis
  Racemase
   TherJR_0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADG81527
UniProt: D5XBX9
LinkDB All DBs
Position
651341..652516
Genome map
AA seq 391 aa AA seqDB search
MKLERLRIRNGFDDRGGFVKTRPAWAEIDLGAIAHNLREIRRITQPQARIMAVVKANAYG
HGAVPVSQVALQNGVSYLGVAMLDEALELRRAGIDAPILILGYTPKEQAEEAVRHNVTQT
IYTLEMARFVSEVGEKLRQRAKVHIKIDTGMTRLGFLPGAETVEKIKEIAALPGLSVEGI
FTHFAVSDIRDKAFTRQQFKLFTDMCAVLEREGVKIPIKHAANTGAIIDMPETHLDMVRL
GISLYGLYPSPEVDRTKVSLKPALSLKAGISHLKEVPRGVTVSYGRTYTTQEKTMIATIP
IGYADGYSRLLSSKAHVLIRGTRAPVAGVICMDQFMVDVGHIPDVAATDEVVLIGRQGDD
CISADELAQLLGTINYEIVCMLSERIPRVYI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactggagcgattgcgtataagaaatggatttgatgacaggggtggttttgtgaaa
actagaccggcttgggcagagatcgacctaggtgccattgctcataatttacgggaaatt
cgccgtatcacccaaccccaggcccggattatggctgtggtcaaagccaatgcatacgga
cacggggctgtgcctgtcagccaggtagctctacaaaacggcgtttcttatctgggtgtg
gccatgctggatgaagctcttgagctgagaagggcaggtatcgatgcgcctattttaatt
ttaggctacaccccaaaagagcaagcagaggaagcagttaggcacaacgtaacccagaca
atatatacccttgaaatggcccgttttgtttcagaagtaggagaaaagttgagacaaagg
gccaaagtacatataaaaatagataccggaatgacccggctcgggtttttgcccggagcg
gagactgtggaaaaaataaaagaaattgcggcgcttcccggattgtctgtggaagggatt
tttactcattttgccgtatcggacataagggataaagcctttacccggcagcaatttaaa
ctgtttaccgatatgtgcgctgtccttgaacgggaaggggtaaagattcccattaaacat
gccgccaatacaggcgcaattattgatatgcccgaaactcaccttgatatggtgcggtta
ggtatatccctgtatgggttatatccttctccggaagtggaccggacaaaagtgtcgtta
aaaccggccttgtcgttaaaagccggaatctcccatctcaaagaagttccccggggggta
accgtcagctacggcaggacctatacgacgcaagaaaagacgatgattgccacaattcct
attggttatgccgacggctattccaggttattgtcctccaaggctcatgtattgataaga
ggaaccagagcccctgtagcgggcgttatttgcatggaccaatttatggtagatgtagga
catatacctgatgttgccgctactgatgaagtggtgctcatcggcaggcagggggacgac
tgtatttctgctgacgaattggcacaactgctgggaactattaattacgaaatagtctgc
atgttaagtgagcggattcccagggtttatatttag

DBGET integrated database retrieval system