KEGG   Thermincola potens: TherJR_1554Help
Entry
TherJR_1554       CDS       T01226                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
tjr  Thermincola potens
Pathway
tjr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tjr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    TherJR_1554
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tjr03400]
    TherJR_1554
Enzymes [BR:tjr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TherJR_1554
DNA repair and recombination proteins [BR:tjr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     TherJR_1554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ADG82407
UniProt: D5XFI6
LinkDB All DBs
Position
complement(1619921..1620865)
Genome map
AA seq 314 aa AA seqDB search
MELTPVVPFEPVSAVQIPHGEQWIAQVKWDGVRVLTYYDGHSVRLYNRRQHERTVQFPEF
VEIRRFCTASSIILDGEIIAFRRGKPSFYEVMKRDGIRQPEKVGHVRKAIPLVYMIFDVL
YFNGEWIIGRTLEERQEILNRCIVPQEDVQLVENFREAEILFDVIKAQGLEGIVCKDISS
RYTIKGKDGRWRKLKNYRDLVAVIGGATYRGNIINAVLLGLYDRDGQLWYIGHAGTGKLT
RAEWRDLTERIKPLVSGECPFVNKPARVKNVTWVKPELTAKIRYIEWTEGHTLRQPSIQA
FVEIPPAQCIFEQS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggagttaacaccggtagttccctttgaaccagtcagtgcagtacaaattccgcacggt
gaacaatggatagcccaggtaaaatgggatggggtccgtgttcttacatattatgacgga
cattctgtccggttatataaccggaggcaacatgaaagaacggtacagtttcccgaattt
gttgaaatcaggcgtttttgtactgcttcgtcaataattcttgatggtgaaatcattgct
ttccgccggggaaaaccttctttttatgaagtaatgaaaagggatggcataaggcagccc
gaaaaagtgggccatgtccgaaaagccattcctctggtttatatgatttttgatgttctt
tactttaatggggaatggattattggccgtactcttgaagaacgtcaggaaatcctgaac
cgatgcatagttccccaagaggatgtgcagttagtggaaaatttccgcgaagcggaaatt
ttgttcgatgtcataaaggcccagggcctggaggggattgtctgtaaggatatcagcagc
agatataccatcaaaggtaaagatggccgatggcgtaaactgaaaaactatcgtgatttg
gtggccgtgattggaggggcaacctataggggtaatatcattaacgctgttctcctggga
ttatacgacagggacggtcagttatggtacataggccacgccggtacgggtaaattgact
agggccgaatggagggatttgactgaacgaattaaacccttagtaagcggtgaatgtcct
tttgtcaataaacctgcacgggtaaaaaatgttacctgggtgaaaccggaattaacggct
aaaatcaggtatattgaatggacagaggggcatacactcaggcagccaagcattcaagct
tttgtcgaaattcctccggctcaatgtatttttgagcaaagttaa

DBGET integrated database retrieval system