KEGG   Thermincola potens: TherJR_1645Help
Entry
TherJR_1645       CDS       T01226                                 

Definition
(GenBank) NUDIX hydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
tjr  Thermincola potens
Brite
KEGG Orthology (KO) [BR:tjr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tjr03400]
    TherJR_1645
Enzymes [BR:tjr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     TherJR_1645
DNA repair and recombination proteins [BR:tjr03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    TherJR_1645
 Prokaryotic type
    TherJR_1645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4 NUDIX_2
Motif
Other DBs
NCBI-ProteinID: ADG82494
UniProt: D5X7C4
LinkDB All DBs
Position
complement(1704095..1704511)
Genome map
AA seq 138 aa AA seqDB search
MNRKVGVIVLQRVTAAILMRDGKVFIAKRKANGLLAGKWEFPGGKIEKGESPEECLKREM
REEFHIEVSVGAFFGESIYHYEHGAIHLLAYYVQWEKGEFRPLVHDEFKWVPVAELKEYG
FAPADIPLAEKLMKVLGG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaaggtaggggtcatagttttgcaaagagtaacggctgcaatattaatgaga
gatggtaaagtttttattgccaaaagaaaagcaaacggcctgttggccggcaaatgggag
tttccgggcgggaaaatagaaaaaggagaaagcccggaagagtgcctgaaacgggagatg
agggaggaatttcacattgaagtaagtgtgggcgcttttttcggtgagagtatttatcac
tacgaacatggcgctattcatttgttagcttattatgtacaatgggaaaagggagagttc
aggcctctcgtacatgacgaatttaaatgggtaccggttgctgagttaaaggaatacggt
tttgcgccggctgatataccattggcagaaaaactgatgaaagtactgggaggttag

DBGET integrated database retrieval system