KEGG   Thermincola potens: TherJR_1787Help
Entry
TherJR_1787       CDS       T01226                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tjr  Thermincola potens
Brite
KEGG Orthology (KO) [BR:tjr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tjr01001]
    TherJR_1787
Enzymes [BR:tjr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TherJR_1787
Protein kinases [BR:tjr01001]
 Serine/threonine kinases: Other
  Bacterial family
   TherJR_1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kdo RIO1 Kinase-like Ribosomal_L12 Haspin_kinase Seadorna_VP7 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ADG82636
UniProt: D5X7R6
LinkDB All DBs
Position
complement(1835835..1837646)
Genome map
AA seq 603 aa AA seqDB search
MALVYKARCTLLQRIVTIKVLRPEFTSDPDFVDRFRNEAQAVARLSHPNIVGIYDVGEEN
GIHYIVMEYIEGRNLKEVIHEKGALPVNEAVNIAKQICDALSHAHENGIIHRDIKPHNIL
LANNGRVKVTDFGIARAVTASTITQHGTILGSVHYISPEQAKGQPATAQSDLYSAGVVLY
EMLTGKVPFEADTPVSVALKHIQEKPAIPSTVNPQVTPELDKVILRAMEKDPGLRYQTAK
SMADDLNTVLLGRISDETKAIDMDEFATKVMPVVSDTGQEGGTGESRKERRRKRVRPMVK
VYAAVIILGILIGLAYGLNAFMYVPEVEVPDVTNMPLDTALRALEAIGLKAEFTRQNHPE
VEAGNVISQEPGPGEKIKKNRTVMLYVSSGPKMVEVPDVGQKDIEAAKIDLENKGFKYNI
KESYSDEVVEGAVISQLPEAGEKAPEGSTVTLEVSKGREPRYVIVPNLIGLTLSEAKKKI
EAANLILSQDIGQEESTEYEAGIVIRQDPVSGERQVLEGTEVKVVLSRGPGPEEKTARVE
MQVPNDGSTHNVKIVVTDVTGTREAYNKTLNPGEQVSEIITYYKEARIEVWMDGTLLEEK
TVK
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggccctggtttacaaagccaggtgcaccctgctgcaaaggattgttaccatcaaagtg
ctcaggccggagtttaccagtgaccctgatttcgttgaccgtttcaggaacgaggcccag
gctgtggctcgcttgtcgcacccgaatattgtgggtatttacgatgtaggtgaagaaaac
ggcattcattatattgttatggaatatatcgaagggaggaacctgaaagaggttattcat
gaaaaaggcgccctccctgtcaacgaggcggtaaatatcgccaagcaaatttgtgacgca
ctgagccacgcccatgaaaacggcatcattcaccgggacattaagccgcacaatatatta
ttagctaacaatgggcgggtaaaagtgactgattttggcattgcccgggctgtgactgcc
agtactattacgcagcacgggacgattctcgggtctgttcactatatttcccccgaacag
gccaagggccagcctgctaccgcgcagtccgatctttattctgcgggtgttgtcctgtat
gagatgctcacaggcaaagtgccttttgaggctgatactcctgtttctgttgctttgaaa
cacatccaggaaaaaccggctattccttctaccgttaacccgcaggttactcccgaatta
gacaaagttatcttgcgagccatggagaaggaccccggtctcaggtaccagacggccaaa
agcatggctgacgacctaaatactgtattattgggccgcattagcgatgagaccaaggcc
atagatatggatgagtttgccaccaaggttatgccggtggttagcgataccggccaggaa
ggcggaacaggggaatcccgcaaagagcggcgccggaaaagagtgcggcccatggtcaaa
gtatatgccgccgttattatccttggtattttaattggacttgcatacggtctcaatgcc
tttatgtatgtgccggaagtagaagtgccagatgtaaccaacatgccccttgacacagct
ttaagagccttggaagcgatcggattaaaagctgaatttaccaggcagaatcacccggaa
gtggaagccggtaatgtaatttcccaggaacccgggccgggggagaaaattaaaaagaac
cgaacggttatgctatatgtaagcagtggtccgaaaatggtggaagtgcccgatgtgggg
cagaaggatattgaggcggcgaaaatagatctggaaaataaaggtttcaaatataacata
aaagagtcttacagcgacgaagtggtggaaggggcggtcatatcccagctaccggaagcg
ggagagaaagcgccggaaggttccacggttacgctggaagtaagcaagggcagagagccg
cgatatgtgattgtgccgaacctaattggtttgacgctcagtgaagccaagaagaaaata
gaagcggccaacctgatcttaagtcaggatatcggtcaggaagaaagtaccgaatacgaa
gccggaattgtcattaggcaggatcctgtttccggggaaaggcaggttctggaaggaact
gaagtaaaggttgtgcttagccggggaccgggaccggaagaaaaaacagcccgggtggaa
atgcaggttcccaatgacggcagtactcataatgtaaaaattgttgttactgatgttacc
ggtacccgggaagcttataacaagacccttaaccccggcgaacaggtatcggaaattata
acctactataaagaagccagaatagaagtatggatggatggcacattactggaggaaaaa
accgttaaataa

DBGET integrated database retrieval system